eF-site ID 5q07-ABCDEFGH PDB Code 5q07 Chain A, B, C, D, E, F, G, H click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-6-morpholin-4-ylpyridin-2-yl)-3-[5-(2-methoxyethyl)-4-methylthiophen-2-yl]sulfonylurea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 95Y A 401 source : AC1 2) chain A residue 21 type ligand sequence G description binding site for residue 95Y A 401 source : AC1 3) chain A residue 22 type ligand sequence R description binding site for residue 95Y A 401 source : AC1 4) chain A residue 24 type ligand sequence A description binding site for residue 95Y A 401 source : AC1 5) chain A residue 25 type ligand sequence R description binding site for residue 95Y A 401 source : AC1 6) chain A residue 26 type ligand sequence G description binding site for residue 95Y A 401 source : AC1 7) chain A residue 27 type ligand sequence T description binding site for residue 95Y A 401 source : AC1 8) chain A residue 28 type ligand sequence G description binding site for residue 95Y A 401 source : AC1 9) chain A residue 29 type ligand sequence E description binding site for residue 95Y A 401 source : AC1 10) chain A residue 30 type ligand sequence L description binding site for residue 95Y A 401 source : AC1 11) chain A residue 31 type ligand sequence T description binding site for residue 95Y A 401 source : AC1 12) chain A residue 160 type ligand sequence V description binding site for residue 95Y A 401 source : AC1 13) chain C residue 26 type ligand sequence G description binding site for residue 95Y A 401 source : AC1 14) chain C residue 27 type ligand sequence T description binding site for residue 95Y A 401 source : AC1 15) chain B residue 17 type ligand sequence V description binding site for residue 95Y B 401 source : AC2 16) chain B residue 20 type ligand sequence E description binding site for residue 95Y B 401 source : AC2 17) chain B residue 21 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 18) chain B residue 22 type ligand sequence R description binding site for residue 95Y B 401 source : AC2 19) chain B residue 24 type ligand sequence A description binding site for residue 95Y B 401 source : AC2 20) chain B residue 25 type ligand sequence R description binding site for residue 95Y B 401 source : AC2 21) chain B residue 26 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 22) chain B residue 27 type ligand sequence T description binding site for residue 95Y B 401 source : AC2 23) chain B residue 28 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 24) chain B residue 29 type ligand sequence E description binding site for residue 95Y B 401 source : AC2 25) chain B residue 30 type ligand sequence L description binding site for residue 95Y B 401 source : AC2 26) chain B residue 31 type ligand sequence T description binding site for residue 95Y B 401 source : AC2 27) chain B residue 160 type ligand sequence V description binding site for residue 95Y B 401 source : AC2 28) chain D residue 26 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 29) chain D residue 27 type ligand sequence T description binding site for residue 95Y B 401 source : AC2 30) chain A residue 26 type ligand sequence G description binding site for residue 95Y C 401 source : AC3 31) chain C residue 17 type ligand sequence V description binding site for residue 95Y C 401 source : AC3 32) chain C residue 21 type ligand sequence G description binding site for residue 95Y C 401 source : AC3 33) chain C residue 22 type ligand sequence R description binding site for residue 95Y C 401 source : AC3 34) chain C residue 24 type ligand sequence A description binding site for residue 95Y C 401 source : AC3 35) chain C residue 26 type ligand sequence G description binding site for residue 95Y C 401 source : AC3 36) chain C residue 28 type ligand sequence G description binding site for residue 95Y C 401 source : AC3 37) chain C residue 29 type ligand sequence E description binding site for residue 95Y C 401 source : AC3 38) chain C residue 30 type ligand sequence L description binding site for residue 95Y C 401 source : AC3 39) chain C residue 31 type ligand sequence T description binding site for residue 95Y C 401 source : AC3 40) chain C residue 177 type ligand sequence M description binding site for residue 95Y C 401 source : AC3 41) chain B residue 26 type ligand sequence G description binding site for residue 95Y D 401 source : AC4 42) chain B residue 27 type ligand sequence T description binding site for residue 95Y D 401 source : AC4 43) chain D residue 17 type ligand sequence V description binding site for residue 95Y D 401 source : AC4 44) chain D residue 21 type ligand sequence G description binding site for residue 95Y D 401 source : AC4 45) chain D residue 22 type ligand sequence R description binding site for residue 95Y D 401 source : AC4 46) chain D residue 24 type ligand sequence A description binding site for residue 95Y D 401 source : AC4 47) chain D residue 25 type ligand sequence R description binding site for residue 95Y D 401 source : AC4 48) chain D residue 26 type ligand sequence G description binding site for residue 95Y D 401 source : AC4 49) chain D residue 27 type ligand sequence T description binding site for residue 95Y D 401 source : AC4 50) chain D residue 28 type ligand sequence G description binding site for residue 95Y D 401 source : AC4 51) chain D residue 30 type ligand sequence L description binding site for residue 95Y D 401 source : AC4 52) chain D residue 31 type ligand sequence T description binding site for residue 95Y D 401 source : AC4 53) chain D residue 177 type ligand sequence M description binding site for residue 95Y D 401 source : AC4 54) chain E residue 17 type ligand sequence V description binding site for residue 95Y E 401 source : AC5 55) chain E residue 21 type ligand sequence G description binding site for residue 95Y E 401 source : AC5 56) chain E residue 22 type ligand sequence R description binding site for residue 95Y E 401 source : AC5 57) chain E residue 25 type ligand sequence R description binding site for residue 95Y E 401 source : AC5 58) chain E residue 26 type ligand sequence G description binding site for residue 95Y E 401 source : AC5 59) chain E residue 27 type ligand sequence T description binding site for residue 95Y E 401 source : AC5 60) chain E residue 28 type ligand sequence G description binding site for residue 95Y E 401 source : AC5 61) chain E residue 29 type ligand sequence E description binding site for residue 95Y E 401 source : AC5 62) chain E residue 30 type ligand sequence L description binding site for residue 95Y E 401 source : AC5 63) chain E residue 31 type ligand sequence T description binding site for residue 95Y E 401 source : AC5 64) chain E residue 160 type ligand sequence V description binding site for residue 95Y E 401 source : AC5 65) chain G residue 27 type ligand sequence T description binding site for residue 95Y E 401 source : AC5 66) chain F residue 21 type ligand sequence G description binding site for residue 95Y F 401 source : AC6 67) chain F residue 22 type ligand sequence R description binding site for residue 95Y F 401 source : AC6 68) chain F residue 26 type ligand sequence G description binding site for residue 95Y F 401 source : AC6 69) chain F residue 27 type ligand sequence T description binding site for residue 95Y F 401 source : AC6 70) chain F residue 28 type ligand sequence G description binding site for residue 95Y F 401 source : AC6 71) chain F residue 30 type ligand sequence L description binding site for residue 95Y F 401 source : AC6 72) chain F residue 31 type ligand sequence T description binding site for residue 95Y F 401 source : AC6 73) chain F residue 160 type ligand sequence V description binding site for residue 95Y F 401 source : AC6 74) chain F residue 177 type ligand sequence M description binding site for residue 95Y F 401 source : AC6 75) chain H residue 26 type ligand sequence G description binding site for residue 95Y F 401 source : AC6 76) chain H residue 27 type ligand sequence T description binding site for residue 95Y F 401 source : AC6 77) chain E residue 26 type ligand sequence G description binding site for residue 95Y G 401 source : AC7 78) chain E residue 27 type ligand sequence T description binding site for residue 95Y G 401 source : AC7 79) chain G residue 21 type ligand sequence G description binding site for residue 95Y G 401 source : AC7 80) chain G residue 22 type ligand sequence R description binding site for residue 95Y G 401 source : AC7 81) chain G residue 25 type ligand sequence R description binding site for residue 95Y G 401 source : AC7 82) chain G residue 26 type ligand sequence G description binding site for residue 95Y G 401 source : AC7 83) chain G residue 27 type ligand sequence T description binding site for residue 95Y G 401 source : AC7 84) chain G residue 28 type ligand sequence G description binding site for residue 95Y G 401 source : AC7 85) chain G residue 29 type ligand sequence E description binding site for residue 95Y G 401 source : AC7 86) chain G residue 30 type ligand sequence L description binding site for residue 95Y G 401 source : AC7 87) chain G residue 31 type ligand sequence T description binding site for residue 95Y G 401 source : AC7 88) chain G residue 160 type ligand sequence V description binding site for residue 95Y G 401 source : AC7 89) chain F residue 26 type ligand sequence G description binding site for residue 95Y H 401 source : AC8 90) chain F residue 27 type ligand sequence T description binding site for residue 95Y H 401 source : AC8 91) chain H residue 17 type ligand sequence V description binding site for residue 95Y H 401 source : AC8 92) chain H residue 20 type ligand sequence E description binding site for residue 95Y H 401 source : AC8 93) chain H residue 21 type ligand sequence G description binding site for residue 95Y H 401 source : AC8 94) chain H residue 22 type ligand sequence R description binding site for residue 95Y H 401 source : AC8 95) chain H residue 25 type ligand sequence R description binding site for residue 95Y H 401 source : AC8 96) chain H residue 26 type ligand sequence G description binding site for residue 95Y H 401 source : AC8 97) chain H residue 28 type ligand sequence G description binding site for residue 95Y H 401 source : AC8 98) chain H residue 29 type ligand sequence E description binding site for residue 95Y H 401 source : AC8 99) chain H residue 30 type ligand sequence L description binding site for residue 95Y H 401 source : AC8 100) chain H residue 31 type ligand sequence T description binding site for residue 95Y H 401 source : AC8 101) chain H residue 160 type ligand sequence V description binding site for residue 95Y H 401 source : AC8 102) chain A residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 103) chain A residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 104) chain A residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 105) chain A residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 106) chain A residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 107) chain A residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 108) chain A residue 177 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence M description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 109) chain C residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 110) chain C residue 31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence T description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_A_401 111) chain A residue 25-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence RGTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 112) chain C residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 113) chain C residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 114) chain C residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 115) chain C residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 116) chain C residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 117) chain C residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 118) chain C residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_C_401 119) chain B residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 120) chain B residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 121) chain B residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 122) chain B residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 123) chain B residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 124) chain B residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 125) chain B residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 126) chain D residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 127) chain D residue 31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence T description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 128) chain B residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 129) chain B residue 31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence T description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 130) chain D residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 131) chain D residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 132) chain D residue 24-32 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELTQ description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 133) chain D residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 134) chain D residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 135) chain D residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 136) chain E residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 137) chain E residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 138) chain E residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 139) chain E residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 140) chain E residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 141) chain E residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 142) chain E residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 143) chain G residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 144) chain G residue 31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence T description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_E_401 145) chain E residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 146) chain G residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 147) chain G residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 148) chain G residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 149) chain G residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 150) chain G residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 151) chain G residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 152) chain G residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_G_401 153) chain F residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 154) chain F residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 155) chain F residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 156) chain F residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 157) chain F residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 158) chain F residue 140 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence R description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 159) chain F residue 160-161 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VA description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 160) chain F residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 161) chain H residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_F_401 162) chain F residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 163) chain F residue 31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence T description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 164) chain H residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 165) chain H residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 166) chain H residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 167) chain H residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 168) chain H residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 169) chain H residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401 170) chain H residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_H_401

Display surface Download Links