eF-site ID 5q07-ABCDEFGH
PDB Code 5q07
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-6-morpholin-4-ylpyridin-2-yl)-3-[5-(2-methoxyethyl)-4-methylthiophen-2-yl]sulfonylurea
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 17
type
ligand
sequence V
description binding site for residue 95Y A 401
source : AC1

2) chain A
residue 21
type
ligand
sequence G
description binding site for residue 95Y A 401
source : AC1

3) chain A
residue 22
type
ligand
sequence R
description binding site for residue 95Y A 401
source : AC1

4) chain A
residue 24
type
ligand
sequence A
description binding site for residue 95Y A 401
source : AC1

5) chain A
residue 25
type
ligand
sequence R
description binding site for residue 95Y A 401
source : AC1

6) chain A
residue 26
type
ligand
sequence G
description binding site for residue 95Y A 401
source : AC1

7) chain A
residue 27
type
ligand
sequence T
description binding site for residue 95Y A 401
source : AC1

8) chain A
residue 28
type
ligand
sequence G
description binding site for residue 95Y A 401
source : AC1

9) chain A
residue 29
type
ligand
sequence E
description binding site for residue 95Y A 401
source : AC1

10) chain A
residue 30
type
ligand
sequence L
description binding site for residue 95Y A 401
source : AC1

11) chain A
residue 31
type
ligand
sequence T
description binding site for residue 95Y A 401
source : AC1

12) chain A
residue 160
type
ligand
sequence V
description binding site for residue 95Y A 401
source : AC1

13) chain C
residue 26
type
ligand
sequence G
description binding site for residue 95Y A 401
source : AC1

14) chain C
residue 27
type
ligand
sequence T
description binding site for residue 95Y A 401
source : AC1

15) chain B
residue 17
type
ligand
sequence V
description binding site for residue 95Y B 401
source : AC2

16) chain B
residue 20
type
ligand
sequence E
description binding site for residue 95Y B 401
source : AC2

17) chain B
residue 21
type
ligand
sequence G
description binding site for residue 95Y B 401
source : AC2

18) chain B
residue 22
type
ligand
sequence R
description binding site for residue 95Y B 401
source : AC2

19) chain B
residue 24
type
ligand
sequence A
description binding site for residue 95Y B 401
source : AC2

20) chain B
residue 25
type
ligand
sequence R
description binding site for residue 95Y B 401
source : AC2

21) chain B
residue 26
type
ligand
sequence G
description binding site for residue 95Y B 401
source : AC2

22) chain B
residue 27
type
ligand
sequence T
description binding site for residue 95Y B 401
source : AC2

23) chain B
residue 28
type
ligand
sequence G
description binding site for residue 95Y B 401
source : AC2

24) chain B
residue 29
type
ligand
sequence E
description binding site for residue 95Y B 401
source : AC2

25) chain B
residue 30
type
ligand
sequence L
description binding site for residue 95Y B 401
source : AC2

26) chain B
residue 31
type
ligand
sequence T
description binding site for residue 95Y B 401
source : AC2

27) chain B
residue 160
type
ligand
sequence V
description binding site for residue 95Y B 401
source : AC2

28) chain D
residue 26
type
ligand
sequence G
description binding site for residue 95Y B 401
source : AC2

29) chain D
residue 27
type
ligand
sequence T
description binding site for residue 95Y B 401
source : AC2

30) chain A
residue 26
type
ligand
sequence G
description binding site for residue 95Y C 401
source : AC3

31) chain C
residue 17
type
ligand
sequence V
description binding site for residue 95Y C 401
source : AC3

32) chain C
residue 21
type
ligand
sequence G
description binding site for residue 95Y C 401
source : AC3

33) chain C
residue 22
type
ligand
sequence R
description binding site for residue 95Y C 401
source : AC3

34) chain C
residue 24
type
ligand
sequence A
description binding site for residue 95Y C 401
source : AC3

35) chain C
residue 26
type
ligand
sequence G
description binding site for residue 95Y C 401
source : AC3

36) chain C
residue 28
type
ligand
sequence G
description binding site for residue 95Y C 401
source : AC3

37) chain C
residue 29
type
ligand
sequence E
description binding site for residue 95Y C 401
source : AC3

38) chain C
residue 30
type
ligand
sequence L
description binding site for residue 95Y C 401
source : AC3

39) chain C
residue 31
type
ligand
sequence T
description binding site for residue 95Y C 401
source : AC3

40) chain C
residue 177
type
ligand
sequence M
description binding site for residue 95Y C 401
source : AC3

41) chain B
residue 26
type
ligand
sequence G
description binding site for residue 95Y D 401
source : AC4

42) chain B
residue 27
type
ligand
sequence T
description binding site for residue 95Y D 401
source : AC4

43) chain D
residue 17
type
ligand
sequence V
description binding site for residue 95Y D 401
source : AC4

44) chain D
residue 21
type
ligand
sequence G
description binding site for residue 95Y D 401
source : AC4

45) chain D
residue 22
type
ligand
sequence R
description binding site for residue 95Y D 401
source : AC4

46) chain D
residue 24
type
ligand
sequence A
description binding site for residue 95Y D 401
source : AC4

47) chain D
residue 25
type
ligand
sequence R
description binding site for residue 95Y D 401
source : AC4

48) chain D
residue 26
type
ligand
sequence G
description binding site for residue 95Y D 401
source : AC4

49) chain D
residue 27
type
ligand
sequence T
description binding site for residue 95Y D 401
source : AC4

50) chain D
residue 28
type
ligand
sequence G
description binding site for residue 95Y D 401
source : AC4

51) chain D
residue 30
type
ligand
sequence L
description binding site for residue 95Y D 401
source : AC4

52) chain D
residue 31
type
ligand
sequence T
description binding site for residue 95Y D 401
source : AC4

53) chain D
residue 177
type
ligand
sequence M
description binding site for residue 95Y D 401
source : AC4

54) chain E
residue 17
type
ligand
sequence V
description binding site for residue 95Y E 401
source : AC5

55) chain E
residue 21
type
ligand
sequence G
description binding site for residue 95Y E 401
source : AC5

56) chain E
residue 22
type
ligand
sequence R
description binding site for residue 95Y E 401
source : AC5

57) chain E
residue 25
type
ligand
sequence R
description binding site for residue 95Y E 401
source : AC5

58) chain E
residue 26
type
ligand
sequence G
description binding site for residue 95Y E 401
source : AC5

59) chain E
residue 27
type
ligand
sequence T
description binding site for residue 95Y E 401
source : AC5

60) chain E
residue 28
type
ligand
sequence G
description binding site for residue 95Y E 401
source : AC5

61) chain E
residue 29
type
ligand
sequence E
description binding site for residue 95Y E 401
source : AC5

62) chain E
residue 30
type
ligand
sequence L
description binding site for residue 95Y E 401
source : AC5

63) chain E
residue 31
type
ligand
sequence T
description binding site for residue 95Y E 401
source : AC5

64) chain E
residue 160
type
ligand
sequence V
description binding site for residue 95Y E 401
source : AC5

65) chain G
residue 27
type
ligand
sequence T
description binding site for residue 95Y E 401
source : AC5

66) chain F
residue 21
type
ligand
sequence G
description binding site for residue 95Y F 401
source : AC6

67) chain F
residue 22
type
ligand
sequence R
description binding site for residue 95Y F 401
source : AC6

68) chain F
residue 26
type
ligand
sequence G
description binding site for residue 95Y F 401
source : AC6

69) chain F
residue 27
type
ligand
sequence T
description binding site for residue 95Y F 401
source : AC6

70) chain F
residue 28
type
ligand
sequence G
description binding site for residue 95Y F 401
source : AC6

71) chain F
residue 30
type
ligand
sequence L
description binding site for residue 95Y F 401
source : AC6

72) chain F
residue 31
type
ligand
sequence T
description binding site for residue 95Y F 401
source : AC6

73) chain F
residue 160
type
ligand
sequence V
description binding site for residue 95Y F 401
source : AC6

74) chain F
residue 177
type
ligand
sequence M
description binding site for residue 95Y F 401
source : AC6

75) chain H
residue 26
type
ligand
sequence G
description binding site for residue 95Y F 401
source : AC6

76) chain H
residue 27
type
ligand
sequence T
description binding site for residue 95Y F 401
source : AC6

77) chain E
residue 26
type
ligand
sequence G
description binding site for residue 95Y G 401
source : AC7

78) chain E
residue 27
type
ligand
sequence T
description binding site for residue 95Y G 401
source : AC7

79) chain G
residue 21
type
ligand
sequence G
description binding site for residue 95Y G 401
source : AC7

80) chain G
residue 22
type
ligand
sequence R
description binding site for residue 95Y G 401
source : AC7

81) chain G
residue 25
type
ligand
sequence R
description binding site for residue 95Y G 401
source : AC7

82) chain G
residue 26
type
ligand
sequence G
description binding site for residue 95Y G 401
source : AC7

83) chain G
residue 27
type
ligand
sequence T
description binding site for residue 95Y G 401
source : AC7

84) chain G
residue 28
type
ligand
sequence G
description binding site for residue 95Y G 401
source : AC7

85) chain G
residue 29
type
ligand
sequence E
description binding site for residue 95Y G 401
source : AC7

86) chain G
residue 30
type
ligand
sequence L
description binding site for residue 95Y G 401
source : AC7

87) chain G
residue 31
type
ligand
sequence T
description binding site for residue 95Y G 401
source : AC7

88) chain G
residue 160
type
ligand
sequence V
description binding site for residue 95Y G 401
source : AC7

89) chain F
residue 26
type
ligand
sequence G
description binding site for residue 95Y H 401
source : AC8

90) chain F
residue 27
type
ligand
sequence T
description binding site for residue 95Y H 401
source : AC8

91) chain H
residue 17
type
ligand
sequence V
description binding site for residue 95Y H 401
source : AC8

92) chain H
residue 20
type
ligand
sequence E
description binding site for residue 95Y H 401
source : AC8

93) chain H
residue 21
type
ligand
sequence G
description binding site for residue 95Y H 401
source : AC8

94) chain H
residue 22
type
ligand
sequence R
description binding site for residue 95Y H 401
source : AC8

95) chain H
residue 25
type
ligand
sequence R
description binding site for residue 95Y H 401
source : AC8

96) chain H
residue 26
type
ligand
sequence G
description binding site for residue 95Y H 401
source : AC8

97) chain H
residue 28
type
ligand
sequence G
description binding site for residue 95Y H 401
source : AC8

98) chain H
residue 29
type
ligand
sequence E
description binding site for residue 95Y H 401
source : AC8

99) chain H
residue 30
type
ligand
sequence L
description binding site for residue 95Y H 401
source : AC8

100) chain H
residue 31
type
ligand
sequence T
description binding site for residue 95Y H 401
source : AC8

101) chain H
residue 160
type
ligand
sequence V
description binding site for residue 95Y H 401
source : AC8

102) chain A
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

103) chain A
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

104) chain A
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

105) chain A
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

106) chain A
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

107) chain A
residue 160
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

108) chain A
residue 177
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence M
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

109) chain C
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

110) chain C
residue 31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence T
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_A_401

111) chain A
residue 25-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence RGTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

112) chain C
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

113) chain C
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

114) chain C
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

115) chain C
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

116) chain C
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

117) chain C
residue 160
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

118) chain C
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_C_401

119) chain B
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

120) chain B
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

121) chain B
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

122) chain B
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

123) chain B
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

124) chain B
residue 160
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

125) chain B
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

126) chain D
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

127) chain D
residue 31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence T
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_B_401

128) chain B
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

129) chain B
residue 31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence T
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

130) chain D
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

131) chain D
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

132) chain D
residue 24-32
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELTQ
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

133) chain D
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

134) chain D
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

135) chain D
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_D_401

136) chain E
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

137) chain E
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

138) chain E
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

139) chain E
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

140) chain E
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

141) chain E
residue 160
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

142) chain E
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

143) chain G
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

144) chain G
residue 31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence T
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_E_401

145) chain E
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

146) chain G
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

147) chain G
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

148) chain G
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

149) chain G
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

150) chain G
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

151) chain G
residue 160
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

152) chain G
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_G_401

153) chain F
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

154) chain F
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

155) chain F
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

156) chain F
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

157) chain F
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

158) chain F
residue 140
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence R
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

159) chain F
residue 160-161
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VA
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

160) chain F
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

161) chain H
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_F_401

162) chain F
residue 26-28
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence GTG
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

163) chain F
residue 31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence T
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

164) chain H
residue 17-18
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

165) chain H
residue 20-22
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

166) chain H
residue 24-31
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

167) chain H
residue 34
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

168) chain H
residue 113
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

169) chain H
residue 160
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401

170) chain H
residue 177-178
type binding
ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence MD
description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95Y_5q07_H_401


Display surface

Download
Links