eF-site ID 5q06-C
PDB Code 5q06
Chain C

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[4-(2-methyl-1,3-thiazol-4-yl)phenyl]sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain C
residue 16
type
ligand
sequence F
description binding site for residue 95V C 401
source : AC3

2) chain C
residue 18
type
ligand
sequence M
description binding site for residue 95V C 401
source : AC3

3) chain C
residue 20
type
ligand
sequence E
description binding site for residue 95V C 401
source : AC3

4) chain C
residue 21
type
ligand
sequence G
description binding site for residue 95V C 401
source : AC3

5) chain C
residue 22
type
ligand
sequence R
description binding site for residue 95V C 401
source : AC3

6) chain C
residue 24
type
ligand
sequence A
description binding site for residue 95V C 401
source : AC3

7) chain C
residue 26
type
ligand
sequence G
description binding site for residue 95V C 401
source : AC3

8) chain C
residue 27
type
ligand
sequence T
description binding site for residue 95V C 401
source : AC3

9) chain C
residue 28
type
ligand
sequence G
description binding site for residue 95V C 401
source : AC3

10) chain C
residue 29
type
ligand
sequence E
description binding site for residue 95V C 401
source : AC3

11) chain C
residue 30
type
ligand
sequence L
description binding site for residue 95V C 401
source : AC3

12) chain C
residue 31
type
ligand
sequence T
description binding site for residue 95V C 401
source : AC3

13) chain C
residue 177
type
ligand
sequence M
description binding site for residue 95V C 401
source : AC3

14) chain C
residue 179
type
ligand
sequence C
description binding site for residue 95V C 401
source : AC3

15) chain C
residue 27-28
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

16) chain C
residue 31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

17) chain C
residue 16-18
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

18) chain C
residue 20-22
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

19) chain C
residue 24-31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

20) chain C
residue 113
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

21) chain C
residue 175
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

22) chain C
residue 177
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

23) chain C
residue 179
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401


Display surface

Download
Links