eF-site ID 5q06-ABCD
PDB Code 5q06
Chain A, B, C, D

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[4-(2-methyl-1,3-thiazol-4-yl)phenyl]sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 16
type
ligand
sequence F
description binding site for residue 95V A 401
source : AC1

2) chain A
residue 20
type
ligand
sequence E
description binding site for residue 95V A 401
source : AC1

3) chain A
residue 21
type
ligand
sequence G
description binding site for residue 95V A 401
source : AC1

4) chain A
residue 22
type
ligand
sequence R
description binding site for residue 95V A 401
source : AC1

5) chain A
residue 26
type
ligand
sequence G
description binding site for residue 95V A 401
source : AC1

6) chain A
residue 27
type
ligand
sequence T
description binding site for residue 95V A 401
source : AC1

7) chain A
residue 28
type
ligand
sequence G
description binding site for residue 95V A 401
source : AC1

8) chain A
residue 29
type
ligand
sequence E
description binding site for residue 95V A 401
source : AC1

9) chain A
residue 30
type
ligand
sequence L
description binding site for residue 95V A 401
source : AC1

10) chain A
residue 31
type
ligand
sequence T
description binding site for residue 95V A 401
source : AC1

11) chain A
residue 177
type
ligand
sequence M
description binding site for residue 95V A 401
source : AC1

12) chain A
residue 179
type
ligand
sequence C
description binding site for residue 95V A 401
source : AC1

13) chain B
residue 16
type
ligand
sequence F
description binding site for residue 95V B 401
source : AC2

14) chain B
residue 20
type
ligand
sequence E
description binding site for residue 95V B 401
source : AC2

15) chain B
residue 21
type
ligand
sequence G
description binding site for residue 95V B 401
source : AC2

16) chain B
residue 22
type
ligand
sequence R
description binding site for residue 95V B 401
source : AC2

17) chain B
residue 26
type
ligand
sequence G
description binding site for residue 95V B 401
source : AC2

18) chain B
residue 27
type
ligand
sequence T
description binding site for residue 95V B 401
source : AC2

19) chain B
residue 28
type
ligand
sequence G
description binding site for residue 95V B 401
source : AC2

20) chain B
residue 29
type
ligand
sequence E
description binding site for residue 95V B 401
source : AC2

21) chain B
residue 30
type
ligand
sequence L
description binding site for residue 95V B 401
source : AC2

22) chain B
residue 31
type
ligand
sequence T
description binding site for residue 95V B 401
source : AC2

23) chain B
residue 177
type
ligand
sequence M
description binding site for residue 95V B 401
source : AC2

24) chain B
residue 179
type
ligand
sequence C
description binding site for residue 95V B 401
source : AC2

25) chain A
residue 27
type
ligand
sequence T
description binding site for residue 95V C 401
source : AC3

26) chain C
residue 16
type
ligand
sequence F
description binding site for residue 95V C 401
source : AC3

27) chain C
residue 18
type
ligand
sequence M
description binding site for residue 95V C 401
source : AC3

28) chain C
residue 20
type
ligand
sequence E
description binding site for residue 95V C 401
source : AC3

29) chain C
residue 21
type
ligand
sequence G
description binding site for residue 95V C 401
source : AC3

30) chain C
residue 22
type
ligand
sequence R
description binding site for residue 95V C 401
source : AC3

31) chain C
residue 24
type
ligand
sequence A
description binding site for residue 95V C 401
source : AC3

32) chain C
residue 26
type
ligand
sequence G
description binding site for residue 95V C 401
source : AC3

33) chain C
residue 27
type
ligand
sequence T
description binding site for residue 95V C 401
source : AC3

34) chain C
residue 28
type
ligand
sequence G
description binding site for residue 95V C 401
source : AC3

35) chain C
residue 29
type
ligand
sequence E
description binding site for residue 95V C 401
source : AC3

36) chain C
residue 30
type
ligand
sequence L
description binding site for residue 95V C 401
source : AC3

37) chain C
residue 31
type
ligand
sequence T
description binding site for residue 95V C 401
source : AC3

38) chain C
residue 177
type
ligand
sequence M
description binding site for residue 95V C 401
source : AC3

39) chain C
residue 179
type
ligand
sequence C
description binding site for residue 95V C 401
source : AC3

40) chain B
residue 27
type
ligand
sequence T
description binding site for residue 95V D 401
source : AC4

41) chain B
residue 28
type
ligand
sequence G
description binding site for residue 95V D 401
source : AC4

42) chain D
residue 16
type
ligand
sequence F
description binding site for residue 95V D 401
source : AC4

43) chain D
residue 18
type
ligand
sequence M
description binding site for residue 95V D 401
source : AC4

44) chain D
residue 20
type
ligand
sequence E
description binding site for residue 95V D 401
source : AC4

45) chain D
residue 21
type
ligand
sequence G
description binding site for residue 95V D 401
source : AC4

46) chain D
residue 22
type
ligand
sequence R
description binding site for residue 95V D 401
source : AC4

47) chain D
residue 26
type
ligand
sequence G
description binding site for residue 95V D 401
source : AC4

48) chain D
residue 28
type
ligand
sequence G
description binding site for residue 95V D 401
source : AC4

49) chain D
residue 29
type
ligand
sequence E
description binding site for residue 95V D 401
source : AC4

50) chain D
residue 30
type
ligand
sequence L
description binding site for residue 95V D 401
source : AC4

51) chain D
residue 31
type
ligand
sequence T
description binding site for residue 95V D 401
source : AC4

52) chain D
residue 177
type
ligand
sequence M
description binding site for residue 95V D 401
source : AC4

53) chain D
residue 179
type
ligand
sequence C
description binding site for residue 95V D 401
source : AC4

54) chain A
residue 16-18
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

55) chain A
residue 20-22
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

56) chain A
residue 24-31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

57) chain A
residue 113
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

58) chain A
residue 175
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

59) chain A
residue 177
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

60) chain A
residue 179
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

61) chain C
residue 27-28
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

62) chain C
residue 31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_A_401

63) chain A
residue 27-28
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

64) chain A
residue 31-32
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

65) chain C
residue 16-18
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

66) chain C
residue 20-22
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

67) chain C
residue 24-31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

68) chain C
residue 113
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

69) chain C
residue 175
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

70) chain C
residue 177
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

71) chain C
residue 179
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_C_401

72) chain B
residue 16-18
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

73) chain B
residue 20-22
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

74) chain B
residue 24-31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

75) chain B
residue 113
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

76) chain B
residue 177
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

77) chain B
residue 179
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

78) chain D
residue 27-28
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

79) chain D
residue 31-32
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_B_401

80) chain B
residue 27-28
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

81) chain B
residue 31-32
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

82) chain D
residue 16-18
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

83) chain D
residue 20-22
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

84) chain D
residue 24-31
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

85) chain D
residue 113
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

86) chain D
residue 177
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401

87) chain D
residue 179
type binding
ligand 95V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-(2-methyl-1,3-thiazol-4-yl)benzene-1-sulfonamide binding site
source pdb_hetatom : 95V_5q06_D_401


Display surface

Download
Links