eF-site ID 5q05-D PDB Code 5q05 Chain D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(2-methoxyethyl)-4-methylthiophen-2-yl]sulfonylurea Classification Hydrolase/Hydrolase Inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain D residue 27 type ligand sequence T description binding site for residue 95S B 401 source : AC2 2) chain D residue 28 type ligand sequence G description binding site for residue 95S B 401 source : AC2 3) chain D residue 21 type ligand sequence G description binding site for residue 95S D 401 source : AC4 4) chain D residue 22 type ligand sequence R description binding site for residue 95S D 401 source : AC4 5) chain D residue 26 type ligand sequence G description binding site for residue 95S D 401 source : AC4 6) chain D residue 27 type ligand sequence T description binding site for residue 95S D 401 source : AC4 7) chain D residue 28 type ligand sequence G description binding site for residue 95S D 401 source : AC4 8) chain D residue 29 type ligand sequence E description binding site for residue 95S D 401 source : AC4 9) chain D residue 30 type ligand sequence L description binding site for residue 95S D 401 source : AC4 10) chain D residue 31 type ligand sequence T description binding site for residue 95S D 401 source : AC4 11) chain D residue 160 type ligand sequence V description binding site for residue 95S D 401 source : AC4 12) chain D residue 27-28 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_B_401 13) chain D residue 31-32 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_B_401 14) chain D residue 17-18 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401 15) chain D residue 20-22 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401 16) chain D residue 24-31 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401 17) chain D residue 34 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401 18) chain D residue 113 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401 19) chain D residue 160 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401 20) chain D residue 177 type binding ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence M description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95S_5q05_D_401

Display surface Download Links