eF-site ID 5q05-D
PDB Code 5q05
Chain D

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(2-methoxyethyl)-4-methylthiophen-2-yl]sulfonylurea
Classification Hydrolase/Hydrolase Inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain D
residue 27
type
ligand
sequence T
description binding site for residue 95S B 401
source : AC2

2) chain D
residue 28
type
ligand
sequence G
description binding site for residue 95S B 401
source : AC2

3) chain D
residue 21
type
ligand
sequence G
description binding site for residue 95S D 401
source : AC4

4) chain D
residue 22
type
ligand
sequence R
description binding site for residue 95S D 401
source : AC4

5) chain D
residue 26
type
ligand
sequence G
description binding site for residue 95S D 401
source : AC4

6) chain D
residue 27
type
ligand
sequence T
description binding site for residue 95S D 401
source : AC4

7) chain D
residue 28
type
ligand
sequence G
description binding site for residue 95S D 401
source : AC4

8) chain D
residue 29
type
ligand
sequence E
description binding site for residue 95S D 401
source : AC4

9) chain D
residue 30
type
ligand
sequence L
description binding site for residue 95S D 401
source : AC4

10) chain D
residue 31
type
ligand
sequence T
description binding site for residue 95S D 401
source : AC4

11) chain D
residue 160
type
ligand
sequence V
description binding site for residue 95S D 401
source : AC4

12) chain D
residue 27-28
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_B_401

13) chain D
residue 31-32
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_B_401

14) chain D
residue 17-18
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401

15) chain D
residue 20-22
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401

16) chain D
residue 24-31
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401

17) chain D
residue 34
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401

18) chain D
residue 113
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401

19) chain D
residue 160
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence V
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401

20) chain D
residue 177
type binding
ligand 95S: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site
source pdb_hetatom : 95S_5q05_D_401


Display surface

Download
Links