eF-site ID 5q04-D PDB Code 5q04 Chain D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-5-chlorothiophen-2-yl)sulfonyl-3-(5-bromo-1,3-thiazol-2-yl)urea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain D residue 17 type ligand sequence V description binding site for residue 95P D 401 source : AC4 2) chain D residue 18 type ligand sequence M description binding site for residue 95P D 401 source : AC4 3) chain D residue 21 type ligand sequence G description binding site for residue 95P D 401 source : AC4 4) chain D residue 22 type ligand sequence R description binding site for residue 95P D 401 source : AC4 5) chain D residue 26 type ligand sequence G description binding site for residue 95P D 401 source : AC4 6) chain D residue 27 type ligand sequence T description binding site for residue 95P D 401 source : AC4 7) chain D residue 28 type ligand sequence G description binding site for residue 95P D 401 source : AC4 8) chain D residue 29 type ligand sequence E description binding site for residue 95P D 401 source : AC4 9) chain D residue 30 type ligand sequence L description binding site for residue 95P D 401 source : AC4 10) chain D residue 31 type ligand sequence T description binding site for residue 95P D 401 source : AC4 11) chain D residue 177 type ligand sequence M description binding site for residue 95P D 401 source : AC4 12) chain D residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 13) chain D residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 14) chain D residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 15) chain D residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 16) chain D residue 24-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence ARGTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 17) chain D residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 18) chain D residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 19) chain D residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401

Display surface Download Links