eF-site ID 5q04-ABCDEFGH PDB Code 5q04 Chain A, B, C, D, E, F, G, H click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-5-chlorothiophen-2-yl)sulfonyl-3-(5-bromo-1,3-thiazol-2-yl)urea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 95P A 401 source : AC1 2) chain A residue 18 type ligand sequence M description binding site for residue 95P A 401 source : AC1 3) chain A residue 21 type ligand sequence G description binding site for residue 95P A 401 source : AC1 4) chain A residue 26 type ligand sequence G description binding site for residue 95P A 401 source : AC1 5) chain A residue 27 type ligand sequence T description binding site for residue 95P A 401 source : AC1 6) chain A residue 28 type ligand sequence G description binding site for residue 95P A 401 source : AC1 7) chain A residue 29 type ligand sequence E description binding site for residue 95P A 401 source : AC1 8) chain A residue 30 type ligand sequence L description binding site for residue 95P A 401 source : AC1 9) chain A residue 31 type ligand sequence T description binding site for residue 95P A 401 source : AC1 10) chain A residue 177 type ligand sequence M description binding site for residue 95P A 401 source : AC1 11) chain B residue 17 type ligand sequence V description binding site for residue 95P B 401 source : AC2 12) chain B residue 18 type ligand sequence M description binding site for residue 95P B 401 source : AC2 13) chain B residue 21 type ligand sequence G description binding site for residue 95P B 401 source : AC2 14) chain B residue 22 type ligand sequence R description binding site for residue 95P B 401 source : AC2 15) chain B residue 24 type ligand sequence A description binding site for residue 95P B 401 source : AC2 16) chain B residue 26 type ligand sequence G description binding site for residue 95P B 401 source : AC2 17) chain B residue 27 type ligand sequence T description binding site for residue 95P B 401 source : AC2 18) chain B residue 28 type ligand sequence G description binding site for residue 95P B 401 source : AC2 19) chain B residue 29 type ligand sequence E description binding site for residue 95P B 401 source : AC2 20) chain B residue 30 type ligand sequence L description binding site for residue 95P B 401 source : AC2 21) chain B residue 31 type ligand sequence T description binding site for residue 95P B 401 source : AC2 22) chain B residue 177 type ligand sequence M description binding site for residue 95P B 401 source : AC2 23) chain A residue 27 type ligand sequence T description binding site for residue 95P C 401 source : AC3 24) chain C residue 18 type ligand sequence M description binding site for residue 95P C 401 source : AC3 25) chain C residue 21 type ligand sequence G description binding site for residue 95P C 401 source : AC3 26) chain C residue 22 type ligand sequence R description binding site for residue 95P C 401 source : AC3 27) chain C residue 24 type ligand sequence A description binding site for residue 95P C 401 source : AC3 28) chain C residue 26 type ligand sequence G description binding site for residue 95P C 401 source : AC3 29) chain C residue 27 type ligand sequence T description binding site for residue 95P C 401 source : AC3 30) chain C residue 28 type ligand sequence G description binding site for residue 95P C 401 source : AC3 31) chain C residue 29 type ligand sequence E description binding site for residue 95P C 401 source : AC3 32) chain C residue 30 type ligand sequence L description binding site for residue 95P C 401 source : AC3 33) chain C residue 31 type ligand sequence T description binding site for residue 95P C 401 source : AC3 34) chain C residue 177 type ligand sequence M description binding site for residue 95P C 401 source : AC3 35) chain D residue 17 type ligand sequence V description binding site for residue 95P D 401 source : AC4 36) chain D residue 18 type ligand sequence M description binding site for residue 95P D 401 source : AC4 37) chain D residue 21 type ligand sequence G description binding site for residue 95P D 401 source : AC4 38) chain D residue 22 type ligand sequence R description binding site for residue 95P D 401 source : AC4 39) chain D residue 26 type ligand sequence G description binding site for residue 95P D 401 source : AC4 40) chain D residue 27 type ligand sequence T description binding site for residue 95P D 401 source : AC4 41) chain D residue 28 type ligand sequence G description binding site for residue 95P D 401 source : AC4 42) chain D residue 29 type ligand sequence E description binding site for residue 95P D 401 source : AC4 43) chain D residue 30 type ligand sequence L description binding site for residue 95P D 401 source : AC4 44) chain D residue 31 type ligand sequence T description binding site for residue 95P D 401 source : AC4 45) chain D residue 177 type ligand sequence M description binding site for residue 95P D 401 source : AC4 46) chain E residue 17 type ligand sequence V description binding site for residue 95P E 401 source : AC5 47) chain E residue 18 type ligand sequence M description binding site for residue 95P E 401 source : AC5 48) chain E residue 21 type ligand sequence G description binding site for residue 95P E 401 source : AC5 49) chain E residue 22 type ligand sequence R description binding site for residue 95P E 401 source : AC5 50) chain E residue 26 type ligand sequence G description binding site for residue 95P E 401 source : AC5 51) chain E residue 27 type ligand sequence T description binding site for residue 95P E 401 source : AC5 52) chain E residue 28 type ligand sequence G description binding site for residue 95P E 401 source : AC5 53) chain E residue 29 type ligand sequence E description binding site for residue 95P E 401 source : AC5 54) chain E residue 30 type ligand sequence L description binding site for residue 95P E 401 source : AC5 55) chain E residue 31 type ligand sequence T description binding site for residue 95P E 401 source : AC5 56) chain F residue 18 type ligand sequence M description binding site for residue 95P F 401 source : AC6 57) chain F residue 21 type ligand sequence G description binding site for residue 95P F 401 source : AC6 58) chain F residue 22 type ligand sequence R description binding site for residue 95P F 401 source : AC6 59) chain F residue 26 type ligand sequence G description binding site for residue 95P F 401 source : AC6 60) chain F residue 27 type ligand sequence T description binding site for residue 95P F 401 source : AC6 61) chain F residue 28 type ligand sequence G description binding site for residue 95P F 401 source : AC6 62) chain F residue 29 type ligand sequence E description binding site for residue 95P F 401 source : AC6 63) chain F residue 30 type ligand sequence L description binding site for residue 95P F 401 source : AC6 64) chain F residue 31 type ligand sequence T description binding site for residue 95P F 401 source : AC6 65) chain F residue 177 type ligand sequence M description binding site for residue 95P F 401 source : AC6 66) chain H residue 27 type ligand sequence T description binding site for residue 95P F 401 source : AC6 67) chain G residue 18 type ligand sequence M description binding site for residue 95P G 401 source : AC7 68) chain G residue 21 type ligand sequence G description binding site for residue 95P G 401 source : AC7 69) chain G residue 22 type ligand sequence R description binding site for residue 95P G 401 source : AC7 70) chain G residue 26 type ligand sequence G description binding site for residue 95P G 401 source : AC7 71) chain G residue 27 type ligand sequence T description binding site for residue 95P G 401 source : AC7 72) chain G residue 28 type ligand sequence G description binding site for residue 95P G 401 source : AC7 73) chain G residue 29 type ligand sequence E description binding site for residue 95P G 401 source : AC7 74) chain G residue 30 type ligand sequence L description binding site for residue 95P G 401 source : AC7 75) chain G residue 31 type ligand sequence T description binding site for residue 95P G 401 source : AC7 76) chain H residue 17 type ligand sequence V description binding site for residue 95P H 401 source : AC8 77) chain H residue 18 type ligand sequence M description binding site for residue 95P H 401 source : AC8 78) chain H residue 21 type ligand sequence G description binding site for residue 95P H 401 source : AC8 79) chain H residue 22 type ligand sequence R description binding site for residue 95P H 401 source : AC8 80) chain H residue 24 type ligand sequence A description binding site for residue 95P H 401 source : AC8 81) chain H residue 26 type ligand sequence G description binding site for residue 95P H 401 source : AC8 82) chain H residue 27 type ligand sequence T description binding site for residue 95P H 401 source : AC8 83) chain H residue 28 type ligand sequence G description binding site for residue 95P H 401 source : AC8 84) chain H residue 29 type ligand sequence E description binding site for residue 95P H 401 source : AC8 85) chain H residue 30 type ligand sequence L description binding site for residue 95P H 401 source : AC8 86) chain H residue 31 type ligand sequence T description binding site for residue 95P H 401 source : AC8 87) chain A residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 88) chain A residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 89) chain A residue 24-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence ARGTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 90) chain A residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 91) chain A residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 92) chain A residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 93) chain C residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 94) chain C residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 95) chain A residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 96) chain A residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 97) chain C residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 98) chain C residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 99) chain C residue 24 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence A description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 100) chain C residue 26-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence GTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 101) chain C residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 102) chain C residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 103) chain C residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 104) chain B residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 105) chain B residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 106) chain B residue 24 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence A description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 107) chain B residue 26-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence GTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 108) chain B residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 109) chain B residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 110) chain B residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 111) chain D residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 112) chain D residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_B_401 113) chain B residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 114) chain B residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 115) chain D residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 116) chain D residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 117) chain D residue 24-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence ARGTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 118) chain D residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 119) chain D residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 120) chain D residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_D_401 121) chain E residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 122) chain E residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 123) chain E residue 24 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence A description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 124) chain E residue 26-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence GTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 125) chain E residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 126) chain E residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 127) chain E residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 128) chain G residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 129) chain G residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_E_401 130) chain E residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 131) chain E residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 132) chain G residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 133) chain G residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 134) chain G residue 24-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence ARGTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 135) chain G residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 136) chain G residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 137) chain G residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_G_401 138) chain F residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 139) chain F residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 140) chain F residue 24 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence A description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 141) chain F residue 26-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence GTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 142) chain F residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 143) chain F residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 144) chain F residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 145) chain H residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 146) chain H residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_F_401 147) chain F residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 148) chain F residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 149) chain H residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 150) chain H residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 151) chain H residue 24-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence ARGTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 152) chain H residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 153) chain H residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401 154) chain H residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_H_401

Display surface Download Links