eF-site ID 5q04-A PDB Code 5q04 Chain A click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-5-chlorothiophen-2-yl)sulfonyl-3-(5-bromo-1,3-thiazol-2-yl)urea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 95P A 401 source : AC1 2) chain A residue 18 type ligand sequence M description binding site for residue 95P A 401 source : AC1 3) chain A residue 21 type ligand sequence G description binding site for residue 95P A 401 source : AC1 4) chain A residue 26 type ligand sequence G description binding site for residue 95P A 401 source : AC1 5) chain A residue 27 type ligand sequence T description binding site for residue 95P A 401 source : AC1 6) chain A residue 28 type ligand sequence G description binding site for residue 95P A 401 source : AC1 7) chain A residue 29 type ligand sequence E description binding site for residue 95P A 401 source : AC1 8) chain A residue 30 type ligand sequence L description binding site for residue 95P A 401 source : AC1 9) chain A residue 31 type ligand sequence T description binding site for residue 95P A 401 source : AC1 10) chain A residue 177 type ligand sequence M description binding site for residue 95P A 401 source : AC1 11) chain A residue 27 type ligand sequence T description binding site for residue 95P C 401 source : AC3 12) chain A residue 17-18 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence VM description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 13) chain A residue 20-22 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence EGR description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 14) chain A residue 24-31 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence ARGTGELT description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 15) chain A residue 34 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence L description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 16) chain A residue 113 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence Y description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 17) chain A residue 177 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence M description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_A_401 18) chain A residue 27-28 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TG description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401 19) chain A residue 31-32 type binding ligand 95P: 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide sequence TQ description 4-bromo-N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-chlorothiophene-2-sulfonamide binding site source pdb_hetatom : 95P_5q04_C_401

Display surface Download Links