eF-site ID 5q03-F
PDB Code 5q03
Chain F

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(2-methylpropyl)thiophen-2-yl]sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain F
residue 18
type
ligand
sequence M
description binding site for residue 95M F 401
source : AC6

2) chain F
residue 21
type
ligand
sequence G
description binding site for residue 95M F 401
source : AC6

3) chain F
residue 26
type
ligand
sequence G
description binding site for residue 95M F 401
source : AC6

4) chain F
residue 27
type
ligand
sequence T
description binding site for residue 95M F 401
source : AC6

5) chain F
residue 28
type
ligand
sequence G
description binding site for residue 95M F 401
source : AC6

6) chain F
residue 30
type
ligand
sequence L
description binding site for residue 95M F 401
source : AC6

7) chain F
residue 31
type
ligand
sequence T
description binding site for residue 95M F 401
source : AC6

8) chain F
residue 27
type
ligand
sequence T
description binding site for residue 95M H 401
source : AC8

9) chain F
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

10) chain F
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

11) chain F
residue 24-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

12) chain F
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

13) chain F
residue 160
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence V
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

14) chain F
residue 177
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

15) chain F
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

16) chain F
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401


Display surface

Download
Links