eF-site ID 5q03-ABCDEFGH
PDB Code 5q03
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(2-methylpropyl)thiophen-2-yl]sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 21
type
ligand
sequence G
description binding site for residue 95M A 401
source : AC1

2) chain A
residue 22
type
ligand
sequence R
description binding site for residue 95M A 401
source : AC1

3) chain A
residue 26
type
ligand
sequence G
description binding site for residue 95M A 401
source : AC1

4) chain A
residue 27
type
ligand
sequence T
description binding site for residue 95M A 401
source : AC1

5) chain A
residue 28
type
ligand
sequence G
description binding site for residue 95M A 401
source : AC1

6) chain A
residue 30
type
ligand
sequence L
description binding site for residue 95M A 401
source : AC1

7) chain A
residue 31
type
ligand
sequence T
description binding site for residue 95M A 401
source : AC1

8) chain A
residue 177
type
ligand
sequence M
description binding site for residue 95M A 401
source : AC1

9) chain B
residue 21
type
ligand
sequence G
description binding site for residue 95M B 401
source : AC2

10) chain B
residue 22
type
ligand
sequence R
description binding site for residue 95M B 401
source : AC2

11) chain B
residue 24
type
ligand
sequence A
description binding site for residue 95M B 401
source : AC2

12) chain B
residue 26
type
ligand
sequence G
description binding site for residue 95M B 401
source : AC2

13) chain B
residue 27
type
ligand
sequence T
description binding site for residue 95M B 401
source : AC2

14) chain B
residue 28
type
ligand
sequence G
description binding site for residue 95M B 401
source : AC2

15) chain B
residue 30
type
ligand
sequence L
description binding site for residue 95M B 401
source : AC2

16) chain B
residue 31
type
ligand
sequence T
description binding site for residue 95M B 401
source : AC2

17) chain B
residue 177
type
ligand
sequence M
description binding site for residue 95M B 401
source : AC2

18) chain C
residue 18
type
ligand
sequence M
description binding site for residue 95M C 401
source : AC3

19) chain C
residue 20
type
ligand
sequence E
description binding site for residue 95M C 401
source : AC3

20) chain C
residue 21
type
ligand
sequence G
description binding site for residue 95M C 401
source : AC3

21) chain C
residue 22
type
ligand
sequence R
description binding site for residue 95M C 401
source : AC3

22) chain C
residue 26
type
ligand
sequence G
description binding site for residue 95M C 401
source : AC3

23) chain C
residue 27
type
ligand
sequence T
description binding site for residue 95M C 401
source : AC3

24) chain C
residue 28
type
ligand
sequence G
description binding site for residue 95M C 401
source : AC3

25) chain C
residue 29
type
ligand
sequence E
description binding site for residue 95M C 401
source : AC3

26) chain C
residue 30
type
ligand
sequence L
description binding site for residue 95M C 401
source : AC3

27) chain C
residue 31
type
ligand
sequence T
description binding site for residue 95M C 401
source : AC3

28) chain C
residue 177
type
ligand
sequence M
description binding site for residue 95M C 401
source : AC3

29) chain B
residue 27
type
ligand
sequence T
description binding site for residue 95M D 401
source : AC4

30) chain D
residue 20
type
ligand
sequence E
description binding site for residue 95M D 401
source : AC4

31) chain D
residue 21
type
ligand
sequence G
description binding site for residue 95M D 401
source : AC4

32) chain D
residue 22
type
ligand
sequence R
description binding site for residue 95M D 401
source : AC4

33) chain D
residue 26
type
ligand
sequence G
description binding site for residue 95M D 401
source : AC4

34) chain D
residue 27
type
ligand
sequence T
description binding site for residue 95M D 401
source : AC4

35) chain D
residue 28
type
ligand
sequence G
description binding site for residue 95M D 401
source : AC4

36) chain D
residue 30
type
ligand
sequence L
description binding site for residue 95M D 401
source : AC4

37) chain D
residue 31
type
ligand
sequence T
description binding site for residue 95M D 401
source : AC4

38) chain D
residue 177
type
ligand
sequence M
description binding site for residue 95M D 401
source : AC4

39) chain E
residue 18
type
ligand
sequence M
description binding site for residue 95M E 401
source : AC5

40) chain E
residue 21
type
ligand
sequence G
description binding site for residue 95M E 401
source : AC5

41) chain E
residue 22
type
ligand
sequence R
description binding site for residue 95M E 401
source : AC5

42) chain E
residue 26
type
ligand
sequence G
description binding site for residue 95M E 401
source : AC5

43) chain E
residue 27
type
ligand
sequence T
description binding site for residue 95M E 401
source : AC5

44) chain E
residue 28
type
ligand
sequence G
description binding site for residue 95M E 401
source : AC5

45) chain E
residue 30
type
ligand
sequence L
description binding site for residue 95M E 401
source : AC5

46) chain E
residue 31
type
ligand
sequence T
description binding site for residue 95M E 401
source : AC5

47) chain E
residue 177
type
ligand
sequence M
description binding site for residue 95M E 401
source : AC5

48) chain F
residue 18
type
ligand
sequence M
description binding site for residue 95M F 401
source : AC6

49) chain F
residue 21
type
ligand
sequence G
description binding site for residue 95M F 401
source : AC6

50) chain F
residue 26
type
ligand
sequence G
description binding site for residue 95M F 401
source : AC6

51) chain F
residue 27
type
ligand
sequence T
description binding site for residue 95M F 401
source : AC6

52) chain F
residue 28
type
ligand
sequence G
description binding site for residue 95M F 401
source : AC6

53) chain F
residue 30
type
ligand
sequence L
description binding site for residue 95M F 401
source : AC6

54) chain F
residue 31
type
ligand
sequence T
description binding site for residue 95M F 401
source : AC6

55) chain G
residue 18
type
ligand
sequence M
description binding site for residue 95M G 401
source : AC7

56) chain G
residue 21
type
ligand
sequence G
description binding site for residue 95M G 401
source : AC7

57) chain G
residue 22
type
ligand
sequence R
description binding site for residue 95M G 401
source : AC7

58) chain G
residue 26
type
ligand
sequence G
description binding site for residue 95M G 401
source : AC7

59) chain G
residue 27
type
ligand
sequence T
description binding site for residue 95M G 401
source : AC7

60) chain G
residue 28
type
ligand
sequence G
description binding site for residue 95M G 401
source : AC7

61) chain G
residue 30
type
ligand
sequence L
description binding site for residue 95M G 401
source : AC7

62) chain G
residue 31
type
ligand
sequence T
description binding site for residue 95M G 401
source : AC7

63) chain G
residue 177
type
ligand
sequence M
description binding site for residue 95M G 401
source : AC7

64) chain F
residue 27
type
ligand
sequence T
description binding site for residue 95M H 401
source : AC8

65) chain H
residue 20
type
ligand
sequence E
description binding site for residue 95M H 401
source : AC8

66) chain H
residue 21
type
ligand
sequence G
description binding site for residue 95M H 401
source : AC8

67) chain H
residue 22
type
ligand
sequence R
description binding site for residue 95M H 401
source : AC8

68) chain H
residue 24
type
ligand
sequence A
description binding site for residue 95M H 401
source : AC8

69) chain H
residue 26
type
ligand
sequence G
description binding site for residue 95M H 401
source : AC8

70) chain H
residue 28
type
ligand
sequence G
description binding site for residue 95M H 401
source : AC8

71) chain H
residue 30
type
ligand
sequence L
description binding site for residue 95M H 401
source : AC8

72) chain H
residue 31
type
ligand
sequence T
description binding site for residue 95M H 401
source : AC8

73) chain H
residue 177
type
ligand
sequence M
description binding site for residue 95M H 401
source : AC8

74) chain A
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

75) chain A
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

76) chain A
residue 24-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

77) chain A
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

78) chain A
residue 177-179
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

79) chain C
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

80) chain C
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_A_401

81) chain A
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

82) chain A
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

83) chain C
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

84) chain C
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

85) chain C
residue 24-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

86) chain C
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

87) chain C
residue 177
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

88) chain C
residue 179
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_C_401

89) chain B
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

90) chain B
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

91) chain B
residue 24
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

92) chain B
residue 26-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

93) chain B
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

94) chain B
residue 177-179
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

95) chain D
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

96) chain D
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_B_401

97) chain B
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

98) chain B
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

99) chain D
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

100) chain D
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

101) chain D
residue 24
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

102) chain D
residue 26-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

103) chain D
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

104) chain D
residue 160
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence V
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

105) chain D
residue 177
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_D_401

106) chain E
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

107) chain E
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

108) chain E
residue 24
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

109) chain E
residue 26-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

110) chain E
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

111) chain E
residue 177-179
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

112) chain G
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

113) chain G
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_E_401

114) chain E
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

115) chain E
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

116) chain G
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

117) chain G
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

118) chain G
residue 24-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

119) chain G
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

120) chain G
residue 177-179
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_G_401

121) chain F
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

122) chain F
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

123) chain F
residue 24-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

124) chain F
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

125) chain F
residue 160
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence V
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

126) chain F
residue 177
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

127) chain H
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

128) chain H
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_F_401

129) chain F
residue 27-28
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

130) chain F
residue 31-32
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

131) chain H
residue 17-18
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

132) chain H
residue 20-22
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

133) chain H
residue 24
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

134) chain H
residue 26-31
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

135) chain H
residue 113
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

136) chain H
residue 160
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence V
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401

137) chain H
residue 177
type binding
ligand 95M: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(2-methylpropyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 95M_5q03_H_401


Display surface

Download
Links