eF-site ID 5q01-E PDB Code 5q01 Chain E click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[4-(4,5-dichloro-2-methylpyrazol-3-yl)oxyphenyl]sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain E residue 21 type ligand sequence G description binding site for residue 95G E 401 source : AC5 2) chain E residue 24 type ligand sequence A description binding site for residue 95G E 401 source : AC5 3) chain E residue 26 type ligand sequence G description binding site for residue 95G E 401 source : AC5 4) chain E residue 27 type ligand sequence T description binding site for residue 95G E 401 source : AC5 5) chain E residue 28 type ligand sequence G description binding site for residue 95G E 401 source : AC5 6) chain E residue 29 type ligand sequence E description binding site for residue 95G E 401 source : AC5 7) chain E residue 30 type ligand sequence L description binding site for residue 95G E 401 source : AC5 8) chain E residue 31 type ligand sequence T description binding site for residue 95G E 401 source : AC5 9) chain E residue 34 type ligand sequence L description binding site for residue 95G E 401 source : AC5 10) chain E residue 161 type ligand sequence A description binding site for residue 95G E 401 source : AC5 11) chain E residue 175 type ligand sequence L description binding site for residue 95G E 401 source : AC5 12) chain E residue 177 type ligand sequence M description binding site for residue 95G E 401 source : AC5 13) chain E residue 27 type ligand sequence T description binding site for residue 95G G 401 source : AC7 14) chain E residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 15) chain E residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 16) chain E residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 17) chain E residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 18) chain E residue 113 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 19) chain E residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 20) chain E residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 21) chain E residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 22) chain E residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401

Display surface Download Links