eF-site ID 5q01-ABCDEFGH PDB Code 5q01 Chain A, B, C, D, E, F, G, H click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[4-(4,5-dichloro-2-methylpyrazol-3-yl)oxyphenyl]sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 18 type ligand sequence M description binding site for residue 95G A 401 source : AC1 2) chain A residue 21 type ligand sequence G description binding site for residue 95G A 401 source : AC1 3) chain A residue 22 type ligand sequence R description binding site for residue 95G A 401 source : AC1 4) chain A residue 26 type ligand sequence G description binding site for residue 95G A 401 source : AC1 5) chain A residue 27 type ligand sequence T description binding site for residue 95G A 401 source : AC1 6) chain A residue 28 type ligand sequence G description binding site for residue 95G A 401 source : AC1 7) chain A residue 29 type ligand sequence E description binding site for residue 95G A 401 source : AC1 8) chain A residue 30 type ligand sequence L description binding site for residue 95G A 401 source : AC1 9) chain A residue 31 type ligand sequence T description binding site for residue 95G A 401 source : AC1 10) chain A residue 175 type ligand sequence L description binding site for residue 95G A 401 source : AC1 11) chain A residue 177 type ligand sequence M description binding site for residue 95G A 401 source : AC1 12) chain C residue 27 type ligand sequence T description binding site for residue 95G A 401 source : AC1 13) chain B residue 20 type ligand sequence E description binding site for residue 95G B 401 source : AC2 14) chain B residue 21 type ligand sequence G description binding site for residue 95G B 401 source : AC2 15) chain B residue 22 type ligand sequence R description binding site for residue 95G B 401 source : AC2 16) chain B residue 26 type ligand sequence G description binding site for residue 95G B 401 source : AC2 17) chain B residue 27 type ligand sequence T description binding site for residue 95G B 401 source : AC2 18) chain B residue 28 type ligand sequence G description binding site for residue 95G B 401 source : AC2 19) chain B residue 29 type ligand sequence E description binding site for residue 95G B 401 source : AC2 20) chain B residue 30 type ligand sequence L description binding site for residue 95G B 401 source : AC2 21) chain B residue 31 type ligand sequence T description binding site for residue 95G B 401 source : AC2 22) chain B residue 161 type ligand sequence A description binding site for residue 95G B 401 source : AC2 23) chain B residue 175 type ligand sequence L description binding site for residue 95G B 401 source : AC2 24) chain B residue 177 type ligand sequence M description binding site for residue 95G B 401 source : AC2 25) chain D residue 27 type ligand sequence T description binding site for residue 95G B 401 source : AC2 26) chain C residue 17 type ligand sequence V description binding site for residue 95G C 401 source : AC3 27) chain C residue 20 type ligand sequence E description binding site for residue 95G C 401 source : AC3 28) chain C residue 21 type ligand sequence G description binding site for residue 95G C 401 source : AC3 29) chain C residue 26 type ligand sequence G description binding site for residue 95G C 401 source : AC3 30) chain C residue 27 type ligand sequence T description binding site for residue 95G C 401 source : AC3 31) chain C residue 28 type ligand sequence G description binding site for residue 95G C 401 source : AC3 32) chain C residue 29 type ligand sequence E description binding site for residue 95G C 401 source : AC3 33) chain C residue 30 type ligand sequence L description binding site for residue 95G C 401 source : AC3 34) chain C residue 31 type ligand sequence T description binding site for residue 95G C 401 source : AC3 35) chain C residue 175 type ligand sequence L description binding site for residue 95G C 401 source : AC3 36) chain C residue 177 type ligand sequence M description binding site for residue 95G C 401 source : AC3 37) chain D residue 20 type ligand sequence E description binding site for residue 95G D 401 source : AC4 38) chain D residue 21 type ligand sequence G description binding site for residue 95G D 401 source : AC4 39) chain D residue 26 type ligand sequence G description binding site for residue 95G D 401 source : AC4 40) chain D residue 28 type ligand sequence G description binding site for residue 95G D 401 source : AC4 41) chain D residue 30 type ligand sequence L description binding site for residue 95G D 401 source : AC4 42) chain D residue 31 type ligand sequence T description binding site for residue 95G D 401 source : AC4 43) chain D residue 161 type ligand sequence A description binding site for residue 95G D 401 source : AC4 44) chain D residue 175 type ligand sequence L description binding site for residue 95G D 401 source : AC4 45) chain D residue 177 type ligand sequence M description binding site for residue 95G D 401 source : AC4 46) chain E residue 21 type ligand sequence G description binding site for residue 95G E 401 source : AC5 47) chain E residue 24 type ligand sequence A description binding site for residue 95G E 401 source : AC5 48) chain E residue 26 type ligand sequence G description binding site for residue 95G E 401 source : AC5 49) chain E residue 27 type ligand sequence T description binding site for residue 95G E 401 source : AC5 50) chain E residue 28 type ligand sequence G description binding site for residue 95G E 401 source : AC5 51) chain E residue 29 type ligand sequence E description binding site for residue 95G E 401 source : AC5 52) chain E residue 30 type ligand sequence L description binding site for residue 95G E 401 source : AC5 53) chain E residue 31 type ligand sequence T description binding site for residue 95G E 401 source : AC5 54) chain E residue 34 type ligand sequence L description binding site for residue 95G E 401 source : AC5 55) chain E residue 161 type ligand sequence A description binding site for residue 95G E 401 source : AC5 56) chain E residue 175 type ligand sequence L description binding site for residue 95G E 401 source : AC5 57) chain E residue 177 type ligand sequence M description binding site for residue 95G E 401 source : AC5 58) chain F residue 20 type ligand sequence E description binding site for residue 95G F 401 source : AC6 59) chain F residue 21 type ligand sequence G description binding site for residue 95G F 401 source : AC6 60) chain F residue 22 type ligand sequence R description binding site for residue 95G F 401 source : AC6 61) chain F residue 26 type ligand sequence G description binding site for residue 95G F 401 source : AC6 62) chain F residue 28 type ligand sequence G description binding site for residue 95G F 401 source : AC6 63) chain F residue 29 type ligand sequence E description binding site for residue 95G F 401 source : AC6 64) chain F residue 30 type ligand sequence L description binding site for residue 95G F 401 source : AC6 65) chain F residue 31 type ligand sequence T description binding site for residue 95G F 401 source : AC6 66) chain F residue 161 type ligand sequence A description binding site for residue 95G F 401 source : AC6 67) chain F residue 175 type ligand sequence L description binding site for residue 95G F 401 source : AC6 68) chain F residue 177 type ligand sequence M description binding site for residue 95G F 401 source : AC6 69) chain H residue 27 type ligand sequence T description binding site for residue 95G F 401 source : AC6 70) chain H residue 28 type ligand sequence G description binding site for residue 95G F 401 source : AC6 71) chain E residue 27 type ligand sequence T description binding site for residue 95G G 401 source : AC7 72) chain G residue 21 type ligand sequence G description binding site for residue 95G G 401 source : AC7 73) chain G residue 22 type ligand sequence R description binding site for residue 95G G 401 source : AC7 74) chain G residue 26 type ligand sequence G description binding site for residue 95G G 401 source : AC7 75) chain G residue 27 type ligand sequence T description binding site for residue 95G G 401 source : AC7 76) chain G residue 28 type ligand sequence G description binding site for residue 95G G 401 source : AC7 77) chain G residue 29 type ligand sequence E description binding site for residue 95G G 401 source : AC7 78) chain G residue 30 type ligand sequence L description binding site for residue 95G G 401 source : AC7 79) chain G residue 31 type ligand sequence T description binding site for residue 95G G 401 source : AC7 80) chain G residue 34 type ligand sequence L description binding site for residue 95G G 401 source : AC7 81) chain G residue 175 type ligand sequence L description binding site for residue 95G G 401 source : AC7 82) chain G residue 177 type ligand sequence M description binding site for residue 95G G 401 source : AC7 83) chain F residue 27 type ligand sequence T description binding site for residue 95G H 401 source : AC8 84) chain F residue 28 type ligand sequence G description binding site for residue 95G H 401 source : AC8 85) chain H residue 17 type ligand sequence V description binding site for residue 95G H 401 source : AC8 86) chain H residue 20 type ligand sequence E description binding site for residue 95G H 401 source : AC8 87) chain H residue 21 type ligand sequence G description binding site for residue 95G H 401 source : AC8 88) chain H residue 22 type ligand sequence R description binding site for residue 95G H 401 source : AC8 89) chain H residue 26 type ligand sequence G description binding site for residue 95G H 401 source : AC8 90) chain H residue 27 type ligand sequence T description binding site for residue 95G H 401 source : AC8 91) chain H residue 28 type ligand sequence G description binding site for residue 95G H 401 source : AC8 92) chain H residue 29 type ligand sequence E description binding site for residue 95G H 401 source : AC8 93) chain H residue 30 type ligand sequence L description binding site for residue 95G H 401 source : AC8 94) chain H residue 31 type ligand sequence T description binding site for residue 95G H 401 source : AC8 95) chain H residue 161 type ligand sequence A description binding site for residue 95G H 401 source : AC8 96) chain H residue 175 type ligand sequence L description binding site for residue 95G H 401 source : AC8 97) chain H residue 177 type ligand sequence M description binding site for residue 95G H 401 source : AC8 98) chain A residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 99) chain A residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 100) chain A residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 101) chain A residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 102) chain A residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 103) chain A residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 104) chain C residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 105) chain C residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_A_401 106) chain A residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 107) chain A residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 108) chain C residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 109) chain C residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 110) chain C residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 111) chain C residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 112) chain C residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 113) chain C residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_C_401 114) chain B residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 115) chain B residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 116) chain B residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 117) chain B residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 118) chain B residue 113 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 119) chain B residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 120) chain B residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 121) chain D residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 122) chain D residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_B_401 123) chain B residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 124) chain B residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 125) chain D residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 126) chain D residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 127) chain D residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 128) chain D residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 129) chain D residue 113 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 130) chain D residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 131) chain D residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_D_401 132) chain E residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 133) chain E residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 134) chain E residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 135) chain E residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 136) chain E residue 113 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 137) chain E residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 138) chain E residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 139) chain G residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 140) chain G residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_E_401 141) chain E residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 142) chain E residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 143) chain G residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 144) chain G residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 145) chain G residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 146) chain G residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 147) chain G residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 148) chain G residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_G_401 149) chain F residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 150) chain F residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 151) chain F residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 152) chain F residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 153) chain F residue 113 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 154) chain F residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 155) chain F residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 156) chain H residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 157) chain H residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_F_401 158) chain F residue 27-28 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 159) chain F residue 31-32 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 160) chain H residue 16-18 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 161) chain H residue 20-22 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 162) chain H residue 24-31 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 163) chain H residue 34 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 164) chain H residue 112-113 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence KY description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 165) chain H residue 160-161 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence VA description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401 166) chain H residue 175-177 type binding ligand 95G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide sequence LAM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-4-[(3,4-dichloro-1-methyl-1H-pyrazol-5-yl)oxy]benzene-1-sulfonamide binding site source pdb_hetatom : 95G_5q01_H_401

Display surface Download Links