eF-site ID 5pzz-E
PDB Code 5pzz
Chain E

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3,4-dichlorophenyl)sulfonylurea
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain E
residue 17
type
ligand
sequence V
description binding site for residue 94Y E 401
source : AC5

2) chain E
residue 21
type
ligand
sequence G
description binding site for residue 94Y E 401
source : AC5

3) chain E
residue 22
type
ligand
sequence R
description binding site for residue 94Y E 401
source : AC5

4) chain E
residue 24
type
ligand
sequence A
description binding site for residue 94Y E 401
source : AC5

5) chain E
residue 26
type
ligand
sequence G
description binding site for residue 94Y E 401
source : AC5

6) chain E
residue 27
type
ligand
sequence T
description binding site for residue 94Y E 401
source : AC5

7) chain E
residue 28
type
ligand
sequence G
description binding site for residue 94Y E 401
source : AC5

8) chain E
residue 29
type
ligand
sequence E
description binding site for residue 94Y E 401
source : AC5

9) chain E
residue 30
type
ligand
sequence L
description binding site for residue 94Y E 401
source : AC5

10) chain E
residue 31
type
ligand
sequence T
description binding site for residue 94Y E 401
source : AC5

11) chain E
residue 27
type
ligand
sequence T
description binding site for residue 94Y G 401
source : AC7

12) chain E
residue 17-18
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_E_401

13) chain E
residue 20-22
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_E_401

14) chain E
residue 24-31
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_E_401

15) chain E
residue 34
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_E_401

16) chain E
residue 113
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_E_401

17) chain E
residue 177
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_E_401

18) chain E
residue 27-28
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_G_401

19) chain E
residue 31-32
type binding
ligand 94Y: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-3,4-dichlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94Y_5pzz_G_401


Display surface

Download
Links