eF-site ID 5pzy-ABCDEFGH
PDB Code 5pzy
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(2-chlorophenyl)sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 17
type
ligand
sequence V
description binding site for residue 94V A 401
source : AC1

2) chain A
residue 21
type
ligand
sequence G
description binding site for residue 94V A 401
source : AC1

3) chain A
residue 22
type
ligand
sequence R
description binding site for residue 94V A 401
source : AC1

4) chain A
residue 26
type
ligand
sequence G
description binding site for residue 94V A 401
source : AC1

5) chain A
residue 27
type
ligand
sequence T
description binding site for residue 94V A 401
source : AC1

6) chain A
residue 28
type
ligand
sequence G
description binding site for residue 94V A 401
source : AC1

7) chain A
residue 30
type
ligand
sequence L
description binding site for residue 94V A 401
source : AC1

8) chain A
residue 31
type
ligand
sequence T
description binding site for residue 94V A 401
source : AC1

9) chain C
residue 27
type
ligand
sequence T
description binding site for residue 94V A 401
source : AC1

10) chain B
residue 17
type
ligand
sequence V
description binding site for residue 94V B 401
source : AC2

11) chain B
residue 20
type
ligand
sequence E
description binding site for residue 94V B 401
source : AC2

12) chain B
residue 21
type
ligand
sequence G
description binding site for residue 94V B 401
source : AC2

13) chain B
residue 22
type
ligand
sequence R
description binding site for residue 94V B 401
source : AC2

14) chain B
residue 24
type
ligand
sequence A
description binding site for residue 94V B 401
source : AC2

15) chain B
residue 26
type
ligand
sequence G
description binding site for residue 94V B 401
source : AC2

16) chain B
residue 27
type
ligand
sequence T
description binding site for residue 94V B 401
source : AC2

17) chain B
residue 28
type
ligand
sequence G
description binding site for residue 94V B 401
source : AC2

18) chain B
residue 29
type
ligand
sequence E
description binding site for residue 94V B 401
source : AC2

19) chain B
residue 30
type
ligand
sequence L
description binding site for residue 94V B 401
source : AC2

20) chain B
residue 31
type
ligand
sequence T
description binding site for residue 94V B 401
source : AC2

21) chain A
residue 27
type
ligand
sequence T
description binding site for residue 94V C 401
source : AC3

22) chain C
residue 17
type
ligand
sequence V
description binding site for residue 94V C 401
source : AC3

23) chain C
residue 18
type
ligand
sequence M
description binding site for residue 94V C 401
source : AC3

24) chain C
residue 21
type
ligand
sequence G
description binding site for residue 94V C 401
source : AC3

25) chain C
residue 22
type
ligand
sequence R
description binding site for residue 94V C 401
source : AC3

26) chain C
residue 24
type
ligand
sequence A
description binding site for residue 94V C 401
source : AC3

27) chain C
residue 26
type
ligand
sequence G
description binding site for residue 94V C 401
source : AC3

28) chain C
residue 27
type
ligand
sequence T
description binding site for residue 94V C 401
source : AC3

29) chain C
residue 28
type
ligand
sequence G
description binding site for residue 94V C 401
source : AC3

30) chain C
residue 29
type
ligand
sequence E
description binding site for residue 94V C 401
source : AC3

31) chain C
residue 30
type
ligand
sequence L
description binding site for residue 94V C 401
source : AC3

32) chain C
residue 31
type
ligand
sequence T
description binding site for residue 94V C 401
source : AC3

33) chain D
residue 17
type
ligand
sequence V
description binding site for residue 94V D 401
source : AC4

34) chain D
residue 21
type
ligand
sequence G
description binding site for residue 94V D 401
source : AC4

35) chain D
residue 22
type
ligand
sequence R
description binding site for residue 94V D 401
source : AC4

36) chain D
residue 26
type
ligand
sequence G
description binding site for residue 94V D 401
source : AC4

37) chain D
residue 27
type
ligand
sequence T
description binding site for residue 94V D 401
source : AC4

38) chain D
residue 28
type
ligand
sequence G
description binding site for residue 94V D 401
source : AC4

39) chain D
residue 29
type
ligand
sequence E
description binding site for residue 94V D 401
source : AC4

40) chain D
residue 30
type
ligand
sequence L
description binding site for residue 94V D 401
source : AC4

41) chain D
residue 31
type
ligand
sequence T
description binding site for residue 94V D 401
source : AC4

42) chain E
residue 17
type
ligand
sequence V
description binding site for residue 94V E 401
source : AC5

43) chain E
residue 21
type
ligand
sequence G
description binding site for residue 94V E 401
source : AC5

44) chain E
residue 22
type
ligand
sequence R
description binding site for residue 94V E 401
source : AC5

45) chain E
residue 24
type
ligand
sequence A
description binding site for residue 94V E 401
source : AC5

46) chain E
residue 26
type
ligand
sequence G
description binding site for residue 94V E 401
source : AC5

47) chain E
residue 27
type
ligand
sequence T
description binding site for residue 94V E 401
source : AC5

48) chain E
residue 28
type
ligand
sequence G
description binding site for residue 94V E 401
source : AC5

49) chain E
residue 29
type
ligand
sequence E
description binding site for residue 94V E 401
source : AC5

50) chain E
residue 30
type
ligand
sequence L
description binding site for residue 94V E 401
source : AC5

51) chain E
residue 31
type
ligand
sequence T
description binding site for residue 94V E 401
source : AC5

52) chain G
residue 27
type
ligand
sequence T
description binding site for residue 94V E 401
source : AC5

53) chain F
residue 17
type
ligand
sequence V
description binding site for residue 94V F 401
source : AC6

54) chain F
residue 18
type
ligand
sequence M
description binding site for residue 94V F 401
source : AC6

55) chain F
residue 20
type
ligand
sequence E
description binding site for residue 94V F 401
source : AC6

56) chain F
residue 21
type
ligand
sequence G
description binding site for residue 94V F 401
source : AC6

57) chain F
residue 22
type
ligand
sequence R
description binding site for residue 94V F 401
source : AC6

58) chain F
residue 24
type
ligand
sequence A
description binding site for residue 94V F 401
source : AC6

59) chain F
residue 26
type
ligand
sequence G
description binding site for residue 94V F 401
source : AC6

60) chain F
residue 28
type
ligand
sequence G
description binding site for residue 94V F 401
source : AC6

61) chain F
residue 29
type
ligand
sequence E
description binding site for residue 94V F 401
source : AC6

62) chain F
residue 30
type
ligand
sequence L
description binding site for residue 94V F 401
source : AC6

63) chain F
residue 31
type
ligand
sequence T
description binding site for residue 94V F 401
source : AC6

64) chain H
residue 27
type
ligand
sequence T
description binding site for residue 94V F 401
source : AC6

65) chain E
residue 27
type
ligand
sequence T
description binding site for residue 94V G 401
source : AC7

66) chain E
residue 28
type
ligand
sequence G
description binding site for residue 94V G 401
source : AC7

67) chain G
residue 17
type
ligand
sequence V
description binding site for residue 94V G 401
source : AC7

68) chain G
residue 18
type
ligand
sequence M
description binding site for residue 94V G 401
source : AC7

69) chain G
residue 21
type
ligand
sequence G
description binding site for residue 94V G 401
source : AC7

70) chain G
residue 22
type
ligand
sequence R
description binding site for residue 94V G 401
source : AC7

71) chain G
residue 24
type
ligand
sequence A
description binding site for residue 94V G 401
source : AC7

72) chain G
residue 26
type
ligand
sequence G
description binding site for residue 94V G 401
source : AC7

73) chain G
residue 27
type
ligand
sequence T
description binding site for residue 94V G 401
source : AC7

74) chain G
residue 28
type
ligand
sequence G
description binding site for residue 94V G 401
source : AC7

75) chain G
residue 29
type
ligand
sequence E
description binding site for residue 94V G 401
source : AC7

76) chain G
residue 30
type
ligand
sequence L
description binding site for residue 94V G 401
source : AC7

77) chain G
residue 31
type
ligand
sequence T
description binding site for residue 94V G 401
source : AC7

78) chain H
residue 17
type
ligand
sequence V
description binding site for residue 94V H 401
source : AC8

79) chain H
residue 18
type
ligand
sequence M
description binding site for residue 94V H 401
source : AC8

80) chain H
residue 20
type
ligand
sequence E
description binding site for residue 94V H 401
source : AC8

81) chain H
residue 21
type
ligand
sequence G
description binding site for residue 94V H 401
source : AC8

82) chain H
residue 22
type
ligand
sequence R
description binding site for residue 94V H 401
source : AC8

83) chain H
residue 24
type
ligand
sequence A
description binding site for residue 94V H 401
source : AC8

84) chain H
residue 26
type
ligand
sequence G
description binding site for residue 94V H 401
source : AC8

85) chain H
residue 27
type
ligand
sequence T
description binding site for residue 94V H 401
source : AC8

86) chain H
residue 28
type
ligand
sequence G
description binding site for residue 94V H 401
source : AC8

87) chain H
residue 30
type
ligand
sequence L
description binding site for residue 94V H 401
source : AC8

88) chain H
residue 31
type
ligand
sequence T
description binding site for residue 94V H 401
source : AC8

89) chain A
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

90) chain A
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

91) chain A
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

92) chain A
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

93) chain A
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

94) chain C
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

95) chain C
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_A_401

96) chain A
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

97) chain A
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

98) chain C
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

99) chain C
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

100) chain C
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

101) chain C
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

102) chain C
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_C_401

103) chain B
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

104) chain B
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

105) chain B
residue 24
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

106) chain B
residue 26-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

107) chain B
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

108) chain B
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

109) chain D
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

110) chain D
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_B_401

111) chain B
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

112) chain B
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

113) chain D
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

114) chain D
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

115) chain D
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

116) chain D
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

117) chain D
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_D_401

118) chain E
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

119) chain E
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

120) chain E
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

121) chain E
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

122) chain E
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

123) chain G
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

124) chain G
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_E_401

125) chain E
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

126) chain E
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

127) chain G
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

128) chain G
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

129) chain G
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

130) chain G
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

131) chain G
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_G_401

132) chain F
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

133) chain F
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

134) chain F
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

135) chain F
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

136) chain F
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

137) chain H
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

138) chain H
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_F_401

139) chain F
residue 27-28
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401

140) chain F
residue 31-32
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401

141) chain H
residue 17-18
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401

142) chain H
residue 20-22
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401

143) chain H
residue 24-31
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401

144) chain H
residue 113
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401

145) chain H
residue 177
type binding
ligand 94V: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-chlorobenzene-1-sulfonamide binding site
source pdb_hetatom : 94V_5pzy_H_401


Display surface

Download
Links