eF-site ID 5pzw-C
PDB Code 5pzw
Chain C

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[5-[(3-chlorophenyl)sulfonylcarbamoylamino]pentyl]urea
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain C
residue 17
type
ligand
sequence V
description binding site for residue 94J A 401
source : AC1

2) chain C
residue 18
type
ligand
sequence M
description binding site for residue 94J A 401
source : AC1

3) chain C
residue 21
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

4) chain C
residue 24
type
ligand
sequence A
description binding site for residue 94J A 401
source : AC1

5) chain C
residue 26
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

6) chain C
residue 27
type
ligand
sequence T
description binding site for residue 94J A 401
source : AC1

7) chain C
residue 28
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

8) chain C
residue 29
type
ligand
sequence E
description binding site for residue 94J A 401
source : AC1

9) chain C
residue 30
type
ligand
sequence L
description binding site for residue 94J A 401
source : AC1

10) chain C
residue 31
type
ligand
sequence T
description binding site for residue 94J A 401
source : AC1

11) chain C
residue 17
type
ligand
sequence V
description binding site for residue AMZ A 402
source : AC2

12) chain C
residue 20
type
ligand
sequence E
description binding site for residue AMZ A 402
source : AC2

13) chain C
residue 21
type
ligand
sequence G
description binding site for residue AMZ A 402
source : AC2

14) chain C
residue 26
type
ligand
sequence G
description binding site for residue AMZ A 402
source : AC2

15) chain C
residue 27
type
ligand
sequence T
description binding site for residue AMZ A 402
source : AC2

16) chain C
residue 28
type
ligand
sequence G
description binding site for residue AMZ A 402
source : AC2

17) chain C
residue 29
type
ligand
sequence E
description binding site for residue AMZ A 402
source : AC2

18) chain C
residue 30
type
ligand
sequence L
description binding site for residue AMZ A 402
source : AC2

19) chain C
residue 31
type
ligand
sequence T
description binding site for residue AMZ A 402
source : AC2

20) chain C
residue 112
type
ligand
sequence K
description binding site for residue AMZ A 402
source : AC2

21) chain C
residue 113
type
ligand
sequence Y
description binding site for residue AMZ A 402
source : AC2

22) chain C
residue 160
type
ligand
sequence V
description binding site for residue AMZ A 402
source : AC2

23) chain C
residue 177
type
ligand
sequence M
description binding site for residue AMZ A 402
source : AC2

24) chain C
residue 17-18
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

25) chain C
residue 20-22
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

26) chain C
residue 24-32
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence ARGTGELTQ
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

27) chain C
residue 34
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

28) chain C
residue 113
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence Y
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

29) chain C
residue 177
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

30) chain C
residue 17
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

31) chain C
residue 20-21
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence EG
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

32) chain C
residue 24
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence A
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

33) chain C
residue 26-31
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence GTGELT
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

34) chain C
residue 34
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence L
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

35) chain C
residue 112-113
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence KY
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

36) chain C
residue 160
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

37) chain C
residue 177
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence M
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402


Display surface

Download
Links