eF-site ID 5pzw-B
PDB Code 5pzw
Chain B

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[5-[(3-chlorophenyl)sulfonylcarbamoylamino]pentyl]urea
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain B
residue 17
type
ligand
sequence V
description binding site for residue 94J B 401
source : AC3

2) chain B
residue 18
type
ligand
sequence M
description binding site for residue 94J B 401
source : AC3

3) chain B
residue 21
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

4) chain B
residue 22
type
ligand
sequence R
description binding site for residue 94J B 401
source : AC3

5) chain B
residue 24
type
ligand
sequence A
description binding site for residue 94J B 401
source : AC3

6) chain B
residue 26
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

7) chain B
residue 27
type
ligand
sequence T
description binding site for residue 94J B 401
source : AC3

8) chain B
residue 28
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

9) chain B
residue 29
type
ligand
sequence E
description binding site for residue 94J B 401
source : AC3

10) chain B
residue 30
type
ligand
sequence L
description binding site for residue 94J B 401
source : AC3

11) chain B
residue 31
type
ligand
sequence T
description binding site for residue 94J B 401
source : AC3

12) chain B
residue 17
type
ligand
sequence V
description binding site for residue AMZ D 401
source : AC4

13) chain B
residue 20
type
ligand
sequence E
description binding site for residue AMZ D 401
source : AC4

14) chain B
residue 21
type
ligand
sequence G
description binding site for residue AMZ D 401
source : AC4

15) chain B
residue 27
type
ligand
sequence T
description binding site for residue AMZ D 401
source : AC4

16) chain B
residue 28
type
ligand
sequence G
description binding site for residue AMZ D 401
source : AC4

17) chain B
residue 29
type
ligand
sequence E
description binding site for residue AMZ D 401
source : AC4

18) chain B
residue 30
type
ligand
sequence L
description binding site for residue AMZ D 401
source : AC4

19) chain B
residue 31
type
ligand
sequence T
description binding site for residue AMZ D 401
source : AC4

20) chain B
residue 112
type
ligand
sequence K
description binding site for residue AMZ D 401
source : AC4

21) chain B
residue 113
type
ligand
sequence Y
description binding site for residue AMZ D 401
source : AC4

22) chain B
residue 140
type
ligand
sequence R
description binding site for residue AMZ D 401
source : AC4

23) chain B
residue 17-18
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

24) chain B
residue 20-22
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

25) chain B
residue 24-31
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence ARGTGELT
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

26) chain B
residue 34
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

27) chain B
residue 113
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence Y
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

28) chain B
residue 177
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

29) chain B
residue 17
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

30) chain B
residue 20-21
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence EG
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

31) chain B
residue 24
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence A
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

32) chain B
residue 26-31
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence GTGELT
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

33) chain B
residue 34
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence L
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

34) chain B
residue 112-113
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence KY
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

35) chain B
residue 140
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence R
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

36) chain B
residue 160
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

37) chain B
residue 177
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence M
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401


Display surface

Download
Links