eF-site ID 5pzw-ABCD
PDB Code 5pzw
Chain A, B, C, D

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[5-[(3-chlorophenyl)sulfonylcarbamoylamino]pentyl]urea
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 17
type
ligand
sequence V
description binding site for residue 94J A 401
source : AC1

2) chain A
residue 18
type
ligand
sequence M
description binding site for residue 94J A 401
source : AC1

3) chain A
residue 21
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

4) chain A
residue 24
type
ligand
sequence A
description binding site for residue 94J A 401
source : AC1

5) chain A
residue 26
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

6) chain A
residue 27
type
ligand
sequence T
description binding site for residue 94J A 401
source : AC1

7) chain A
residue 28
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

8) chain A
residue 29
type
ligand
sequence E
description binding site for residue 94J A 401
source : AC1

9) chain A
residue 30
type
ligand
sequence L
description binding site for residue 94J A 401
source : AC1

10) chain A
residue 31
type
ligand
sequence T
description binding site for residue 94J A 401
source : AC1

11) chain C
residue 17
type
ligand
sequence V
description binding site for residue 94J A 401
source : AC1

12) chain C
residue 18
type
ligand
sequence M
description binding site for residue 94J A 401
source : AC1

13) chain C
residue 21
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

14) chain C
residue 24
type
ligand
sequence A
description binding site for residue 94J A 401
source : AC1

15) chain C
residue 26
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

16) chain C
residue 27
type
ligand
sequence T
description binding site for residue 94J A 401
source : AC1

17) chain C
residue 28
type
ligand
sequence G
description binding site for residue 94J A 401
source : AC1

18) chain C
residue 29
type
ligand
sequence E
description binding site for residue 94J A 401
source : AC1

19) chain C
residue 30
type
ligand
sequence L
description binding site for residue 94J A 401
source : AC1

20) chain C
residue 31
type
ligand
sequence T
description binding site for residue 94J A 401
source : AC1

21) chain A
residue 17
type
ligand
sequence V
description binding site for residue AMZ A 402
source : AC2

22) chain A
residue 20
type
ligand
sequence E
description binding site for residue AMZ A 402
source : AC2

23) chain A
residue 27
type
ligand
sequence T
description binding site for residue AMZ A 402
source : AC2

24) chain A
residue 29
type
ligand
sequence E
description binding site for residue AMZ A 402
source : AC2

25) chain A
residue 30
type
ligand
sequence L
description binding site for residue AMZ A 402
source : AC2

26) chain A
residue 31
type
ligand
sequence T
description binding site for residue AMZ A 402
source : AC2

27) chain A
residue 112
type
ligand
sequence K
description binding site for residue AMZ A 402
source : AC2

28) chain A
residue 113
type
ligand
sequence Y
description binding site for residue AMZ A 402
source : AC2

29) chain A
residue 140
type
ligand
sequence R
description binding site for residue AMZ A 402
source : AC2

30) chain C
residue 17
type
ligand
sequence V
description binding site for residue AMZ A 402
source : AC2

31) chain C
residue 20
type
ligand
sequence E
description binding site for residue AMZ A 402
source : AC2

32) chain C
residue 21
type
ligand
sequence G
description binding site for residue AMZ A 402
source : AC2

33) chain C
residue 26
type
ligand
sequence G
description binding site for residue AMZ A 402
source : AC2

34) chain C
residue 27
type
ligand
sequence T
description binding site for residue AMZ A 402
source : AC2

35) chain C
residue 28
type
ligand
sequence G
description binding site for residue AMZ A 402
source : AC2

36) chain C
residue 29
type
ligand
sequence E
description binding site for residue AMZ A 402
source : AC2

37) chain C
residue 30
type
ligand
sequence L
description binding site for residue AMZ A 402
source : AC2

38) chain C
residue 31
type
ligand
sequence T
description binding site for residue AMZ A 402
source : AC2

39) chain C
residue 112
type
ligand
sequence K
description binding site for residue AMZ A 402
source : AC2

40) chain C
residue 113
type
ligand
sequence Y
description binding site for residue AMZ A 402
source : AC2

41) chain C
residue 160
type
ligand
sequence V
description binding site for residue AMZ A 402
source : AC2

42) chain C
residue 177
type
ligand
sequence M
description binding site for residue AMZ A 402
source : AC2

43) chain B
residue 17
type
ligand
sequence V
description binding site for residue 94J B 401
source : AC3

44) chain B
residue 18
type
ligand
sequence M
description binding site for residue 94J B 401
source : AC3

45) chain B
residue 21
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

46) chain B
residue 22
type
ligand
sequence R
description binding site for residue 94J B 401
source : AC3

47) chain B
residue 24
type
ligand
sequence A
description binding site for residue 94J B 401
source : AC3

48) chain B
residue 26
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

49) chain B
residue 27
type
ligand
sequence T
description binding site for residue 94J B 401
source : AC3

50) chain B
residue 28
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

51) chain B
residue 29
type
ligand
sequence E
description binding site for residue 94J B 401
source : AC3

52) chain B
residue 30
type
ligand
sequence L
description binding site for residue 94J B 401
source : AC3

53) chain B
residue 31
type
ligand
sequence T
description binding site for residue 94J B 401
source : AC3

54) chain D
residue 17
type
ligand
sequence V
description binding site for residue 94J B 401
source : AC3

55) chain D
residue 18
type
ligand
sequence M
description binding site for residue 94J B 401
source : AC3

56) chain D
residue 21
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

57) chain D
residue 22
type
ligand
sequence R
description binding site for residue 94J B 401
source : AC3

58) chain D
residue 24
type
ligand
sequence A
description binding site for residue 94J B 401
source : AC3

59) chain D
residue 26
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

60) chain D
residue 27
type
ligand
sequence T
description binding site for residue 94J B 401
source : AC3

61) chain D
residue 28
type
ligand
sequence G
description binding site for residue 94J B 401
source : AC3

62) chain D
residue 29
type
ligand
sequence E
description binding site for residue 94J B 401
source : AC3

63) chain D
residue 30
type
ligand
sequence L
description binding site for residue 94J B 401
source : AC3

64) chain D
residue 31
type
ligand
sequence T
description binding site for residue 94J B 401
source : AC3

65) chain B
residue 17
type
ligand
sequence V
description binding site for residue AMZ D 401
source : AC4

66) chain B
residue 20
type
ligand
sequence E
description binding site for residue AMZ D 401
source : AC4

67) chain B
residue 21
type
ligand
sequence G
description binding site for residue AMZ D 401
source : AC4

68) chain B
residue 27
type
ligand
sequence T
description binding site for residue AMZ D 401
source : AC4

69) chain B
residue 28
type
ligand
sequence G
description binding site for residue AMZ D 401
source : AC4

70) chain B
residue 29
type
ligand
sequence E
description binding site for residue AMZ D 401
source : AC4

71) chain B
residue 30
type
ligand
sequence L
description binding site for residue AMZ D 401
source : AC4

72) chain B
residue 31
type
ligand
sequence T
description binding site for residue AMZ D 401
source : AC4

73) chain B
residue 112
type
ligand
sequence K
description binding site for residue AMZ D 401
source : AC4

74) chain B
residue 113
type
ligand
sequence Y
description binding site for residue AMZ D 401
source : AC4

75) chain B
residue 140
type
ligand
sequence R
description binding site for residue AMZ D 401
source : AC4

76) chain D
residue 17
type
ligand
sequence V
description binding site for residue AMZ D 401
source : AC4

77) chain D
residue 20
type
ligand
sequence E
description binding site for residue AMZ D 401
source : AC4

78) chain D
residue 21
type
ligand
sequence G
description binding site for residue AMZ D 401
source : AC4

79) chain D
residue 27
type
ligand
sequence T
description binding site for residue AMZ D 401
source : AC4

80) chain D
residue 28
type
ligand
sequence G
description binding site for residue AMZ D 401
source : AC4

81) chain D
residue 29
type
ligand
sequence E
description binding site for residue AMZ D 401
source : AC4

82) chain D
residue 30
type
ligand
sequence L
description binding site for residue AMZ D 401
source : AC4

83) chain D
residue 31
type
ligand
sequence T
description binding site for residue AMZ D 401
source : AC4

84) chain D
residue 112
type
ligand
sequence K
description binding site for residue AMZ D 401
source : AC4

85) chain D
residue 113
type
ligand
sequence Y
description binding site for residue AMZ D 401
source : AC4

86) chain D
residue 140
type
ligand
sequence R
description binding site for residue AMZ D 401
source : AC4

87) chain A
residue 17-18
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

88) chain A
residue 20-22
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

89) chain A
residue 24
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence A
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

90) chain A
residue 26-32
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence GTGELTQ
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

91) chain A
residue 34
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

92) chain A
residue 113
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence Y
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

93) chain A
residue 177
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

94) chain C
residue 17-18
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

95) chain C
residue 20-22
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

96) chain C
residue 24-32
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence ARGTGELTQ
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

97) chain C
residue 34
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

98) chain C
residue 113
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence Y
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

99) chain C
residue 177
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_A_401

100) chain A
residue 17
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

101) chain A
residue 20-21
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence EG
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

102) chain A
residue 24
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence A
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

103) chain A
residue 26-31
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence GTGELT
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

104) chain A
residue 34
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence L
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

105) chain A
residue 112-113
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence KY
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

106) chain A
residue 140
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence R
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

107) chain A
residue 160
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

108) chain A
residue 177
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence M
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

109) chain C
residue 17
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

110) chain C
residue 20-21
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence EG
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

111) chain C
residue 24
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence A
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

112) chain C
residue 26-31
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence GTGELT
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

113) chain C
residue 34
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence L
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

114) chain C
residue 112-113
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence KY
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

115) chain C
residue 160
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

116) chain C
residue 177
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence M
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_A_402

117) chain B
residue 17-18
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

118) chain B
residue 20-22
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

119) chain B
residue 24-31
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence ARGTGELT
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

120) chain B
residue 34
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

121) chain B
residue 113
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence Y
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

122) chain B
residue 177
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

123) chain D
residue 17-18
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

124) chain D
residue 20-22
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

125) chain D
residue 24-31
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence ARGTGELT
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

126) chain D
residue 34
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

127) chain D
residue 177
type binding
ligand 94J: N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-(pentane-1,5-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 94J_5pzw_B_401

128) chain B
residue 17
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

129) chain B
residue 20-21
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence EG
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

130) chain B
residue 24
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence A
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

131) chain B
residue 26-31
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence GTGELT
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

132) chain B
residue 34
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence L
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

133) chain B
residue 112-113
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence KY
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

134) chain B
residue 140
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence R
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

135) chain B
residue 160
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

136) chain B
residue 177
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence M
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

137) chain D
residue 17-18
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence VM
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

138) chain D
residue 20-21
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence EG
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

139) chain D
residue 24
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence A
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

140) chain D
residue 26-31
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence GTGELT
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

141) chain D
residue 34
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence L
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

142) chain D
residue 112-113
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence KY
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

143) chain D
residue 140
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence R
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

144) chain D
residue 160
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence V
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401

145) chain D
residue 177
type binding
ligand AMZ: AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
sequence M
description AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE binding site
source pdb_hetatom : AMZ_5pzw_D_401


Display surface

Download
Links