eF-site ID 5pzu-D PDB Code 5pzu Chain D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor [5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl]phosphonic acid Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description Functional site 1) chain D residue 17 type sequence V description binding site for residue 94D D 401 source : AC4 2) chain D residue 20 type sequence E description binding site for residue 94D D 401 source : AC4 3) chain D residue 21 type sequence G description binding site for residue 94D D 401 source : AC4 4) chain D residue 26 type sequence G description binding site for residue 94D D 401 source : AC4 5) chain D residue 27 type sequence T description binding site for residue 94D D 401 source : AC4 6) chain D residue 28 type sequence G description binding site for residue 94D D 401 source : AC4 7) chain D residue 29 type sequence E description binding site for residue 94D D 401 source : AC4 8) chain D residue 30 type sequence L description binding site for residue 94D D 401 source : AC4 9) chain D residue 31 type sequence T description binding site for residue 94D D 401 source : AC4 10) chain D residue 112 type sequence K description binding site for residue 94D D 401 source : AC4 11) chain D residue 113 type sequence Y description binding site for residue 94D D 401 source : AC4 12) chain D residue 140 type sequence R description binding site for residue 94D D 401 source : AC4

Display surface Download Links