eF-site ID 5pzu-C
PDB Code 5pzu
Chain C

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor [5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl]phosphonic acid
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain C
residue 17
type
ligand
sequence V
description binding site for residue 94D C 401
source : AC3

2) chain C
residue 20
type
ligand
sequence E
description binding site for residue 94D C 401
source : AC3

3) chain C
residue 21
type
ligand
sequence G
description binding site for residue 94D C 401
source : AC3

4) chain C
residue 26
type
ligand
sequence G
description binding site for residue 94D C 401
source : AC3

5) chain C
residue 27
type
ligand
sequence T
description binding site for residue 94D C 401
source : AC3

6) chain C
residue 28
type
ligand
sequence G
description binding site for residue 94D C 401
source : AC3

7) chain C
residue 29
type
ligand
sequence E
description binding site for residue 94D C 401
source : AC3

8) chain C
residue 30
type
ligand
sequence L
description binding site for residue 94D C 401
source : AC3

9) chain C
residue 31
type
ligand
sequence T
description binding site for residue 94D C 401
source : AC3

10) chain C
residue 112
type
ligand
sequence K
description binding site for residue 94D C 401
source : AC3

11) chain C
residue 113
type
ligand
sequence Y
description binding site for residue 94D C 401
source : AC3

12) chain C
residue 160
type
ligand
sequence V
description binding site for residue 94D C 401
source : AC3

13) chain C
residue 17-18
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence VM
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

14) chain C
residue 20-21
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence EG
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

15) chain C
residue 24
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence A
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

16) chain C
residue 26-31
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence GTGELT
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

17) chain C
residue 34
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence L
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

18) chain C
residue 112-113
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence KY
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

19) chain C
residue 140
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence R
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

20) chain C
residue 160
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence V
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401

21) chain C
residue 177-178
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence MD
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_C_401


Display surface

Download
Links