eF-site ID 5pzu-B PDB Code 5pzu Chain B click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor [5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl]phosphonic acid Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain B residue 17 type ligand sequence V description binding site for residue 94D B 401 source : AC2 2) chain B residue 21 type ligand sequence G description binding site for residue 94D B 401 source : AC2 3) chain B residue 26 type ligand sequence G description binding site for residue 94D B 401 source : AC2 4) chain B residue 27 type ligand sequence T description binding site for residue 94D B 401 source : AC2 5) chain B residue 28 type ligand sequence G description binding site for residue 94D B 401 source : AC2 6) chain B residue 29 type ligand sequence E description binding site for residue 94D B 401 source : AC2 7) chain B residue 30 type ligand sequence L description binding site for residue 94D B 401 source : AC2 8) chain B residue 31 type ligand sequence T description binding site for residue 94D B 401 source : AC2 9) chain B residue 112 type ligand sequence K description binding site for residue 94D B 401 source : AC2 10) chain B residue 113 type ligand sequence Y description binding site for residue 94D B 401 source : AC2 11) chain B residue 140 type ligand sequence R description binding site for residue 94D B 401 source : AC2 12) chain B residue 177 type ligand sequence M description binding site for residue 94D B 401 source : AC2 13) chain B residue 17-18 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence VM description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 14) chain B residue 20-21 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence EG description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 15) chain B residue 24 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence A description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 16) chain B residue 26-31 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence GTGELT description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 17) chain B residue 34 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence L description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 18) chain B residue 112-113 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence KY description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 19) chain B residue 140 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence R description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 20) chain B residue 160 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence V description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401 21) chain B residue 177-178 type binding ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid sequence MD description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site source pdb_hetatom : 94D_5pzu_B_401

Display surface Download Links