eF-site ID 5pzu-B
PDB Code 5pzu
Chain B

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor [5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl]phosphonic acid
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain B
residue 17
type
ligand
sequence V
description binding site for residue 94D B 401
source : AC2

2) chain B
residue 21
type
ligand
sequence G
description binding site for residue 94D B 401
source : AC2

3) chain B
residue 26
type
ligand
sequence G
description binding site for residue 94D B 401
source : AC2

4) chain B
residue 27
type
ligand
sequence T
description binding site for residue 94D B 401
source : AC2

5) chain B
residue 28
type
ligand
sequence G
description binding site for residue 94D B 401
source : AC2

6) chain B
residue 29
type
ligand
sequence E
description binding site for residue 94D B 401
source : AC2

7) chain B
residue 30
type
ligand
sequence L
description binding site for residue 94D B 401
source : AC2

8) chain B
residue 31
type
ligand
sequence T
description binding site for residue 94D B 401
source : AC2

9) chain B
residue 112
type
ligand
sequence K
description binding site for residue 94D B 401
source : AC2

10) chain B
residue 113
type
ligand
sequence Y
description binding site for residue 94D B 401
source : AC2

11) chain B
residue 140
type
ligand
sequence R
description binding site for residue 94D B 401
source : AC2

12) chain B
residue 177
type
ligand
sequence M
description binding site for residue 94D B 401
source : AC2

13) chain B
residue 17-18
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence VM
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

14) chain B
residue 20-21
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence EG
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

15) chain B
residue 24
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence A
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

16) chain B
residue 26-31
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence GTGELT
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

17) chain B
residue 34
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence L
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

18) chain B
residue 112-113
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence KY
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

19) chain B
residue 140
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence R
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

20) chain B
residue 160
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence V
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401

21) chain B
residue 177-178
type binding
ligand 94D: {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid
sequence MD
description {5-[2-amino-5-(2-methylpropyl)-1,3-thiazol-4-yl]furan-2-yl}phosphonic acid binding site
source pdb_hetatom : 94D_5pzu_B_401


Display surface

Download
Links