eF-site ID 5pzt-H PDB Code 5pzt Chain H click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3-ethyl-4-phenylphenyl)sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV IPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description Functional site 1) chain H residue 17 type sequence V description binding site for residue 947 H 401 source : AC8 2) chain H residue 20 type sequence E description binding site for residue 947 H 401 source : AC8 3) chain H residue 21 type sequence G description binding site for residue 947 H 401 source : AC8 4) chain H residue 22 type sequence R description binding site for residue 947 H 401 source : AC8 5) chain H residue 26 type sequence G description binding site for residue 947 H 401 source : AC8 6) chain H residue 27 type sequence T description binding site for residue 947 H 401 source : AC8 7) chain H residue 28 type sequence G description binding site for residue 947 H 401 source : AC8 8) chain H residue 29 type sequence E description binding site for residue 947 H 401 source : AC8 9) chain H residue 30 type sequence L description binding site for residue 947 H 401 source : AC8 10) chain H residue 31 type sequence T description binding site for residue 947 H 401 source : AC8

Display surface Download Links