eF-site ID 5pzt-C PDB Code 5pzt Chain C click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3-ethyl-4-phenylphenyl)sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV IPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description Functional site 1) chain C residue 17 type sequence V description binding site for residue 947 C 401 source : AC3 2) chain C residue 20 type sequence E description binding site for residue 947 C 401 source : AC3 3) chain C residue 21 type sequence G description binding site for residue 947 C 401 source : AC3 4) chain C residue 22 type sequence R description binding site for residue 947 C 401 source : AC3 5) chain C residue 24 type sequence A description binding site for residue 947 C 401 source : AC3 6) chain C residue 26 type sequence G description binding site for residue 947 C 401 source : AC3 7) chain C residue 27 type sequence T description binding site for residue 947 C 401 source : AC3 8) chain C residue 28 type sequence G description binding site for residue 947 C 401 source : AC3 9) chain C residue 29 type sequence E description binding site for residue 947 C 401 source : AC3 10) chain C residue 30 type sequence L description binding site for residue 947 C 401 source : AC3 11) chain C residue 31 type sequence T description binding site for residue 947 C 401 source : AC3

Display surface Download Links