eF-site ID 5pzt-C PDB Code 5pzt Chain C click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3-ethyl-4-phenylphenyl)sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV IPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain C residue 17 type ligand sequence V description binding site for residue 947 C 401 source : AC3 2) chain C residue 20 type ligand sequence E description binding site for residue 947 C 401 source : AC3 3) chain C residue 21 type ligand sequence G description binding site for residue 947 C 401 source : AC3 4) chain C residue 22 type ligand sequence R description binding site for residue 947 C 401 source : AC3 5) chain C residue 24 type ligand sequence A description binding site for residue 947 C 401 source : AC3 6) chain C residue 26 type ligand sequence G description binding site for residue 947 C 401 source : AC3 7) chain C residue 27 type ligand sequence T description binding site for residue 947 C 401 source : AC3 8) chain C residue 28 type ligand sequence G description binding site for residue 947 C 401 source : AC3 9) chain C residue 29 type ligand sequence E description binding site for residue 947 C 401 source : AC3 10) chain C residue 30 type ligand sequence L description binding site for residue 947 C 401 source : AC3 11) chain C residue 31 type ligand sequence T description binding site for residue 947 C 401 source : AC3 12) chain C residue 27-28 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_A_401 13) chain C residue 31 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence T description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_A_401 14) chain C residue 16-18 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_C_401 15) chain C residue 20-22 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_C_401 16) chain C residue 24-31 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence ARGTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_C_401 17) chain C residue 34 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_C_401 18) chain C residue 113 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_C_401 19) chain C residue 177-179 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence MDC description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_C_401

Display surface Download Links