eF-site ID 5pzt-B
PDB Code 5pzt
Chain B

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3-ethyl-4-phenylphenyl)sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain B
residue 17
type
ligand
sequence V
description binding site for residue 947 B 401
source : AC2

2) chain B
residue 20
type
ligand
sequence E
description binding site for residue 947 B 401
source : AC2

3) chain B
residue 21
type
ligand
sequence G
description binding site for residue 947 B 401
source : AC2

4) chain B
residue 22
type
ligand
sequence R
description binding site for residue 947 B 401
source : AC2

5) chain B
residue 26
type
ligand
sequence G
description binding site for residue 947 B 401
source : AC2

6) chain B
residue 27
type
ligand
sequence T
description binding site for residue 947 B 401
source : AC2

7) chain B
residue 28
type
ligand
sequence G
description binding site for residue 947 B 401
source : AC2

8) chain B
residue 29
type
ligand
sequence E
description binding site for residue 947 B 401
source : AC2

9) chain B
residue 30
type
ligand
sequence L
description binding site for residue 947 B 401
source : AC2

10) chain B
residue 31
type
ligand
sequence T
description binding site for residue 947 B 401
source : AC2

11) chain B
residue 16-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

12) chain B
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

13) chain B
residue 24
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

14) chain B
residue 26-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

15) chain B
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

16) chain B
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

17) chain B
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

18) chain B
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

19) chain B
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401


Display surface

Download
Links