eF-site ID 5pzt-B PDB Code 5pzt Chain B click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3-ethyl-4-phenylphenyl)sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV IPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain B residue 17 type ligand sequence V description binding site for residue 947 B 401 source : AC2 2) chain B residue 20 type ligand sequence E description binding site for residue 947 B 401 source : AC2 3) chain B residue 21 type ligand sequence G description binding site for residue 947 B 401 source : AC2 4) chain B residue 22 type ligand sequence R description binding site for residue 947 B 401 source : AC2 5) chain B residue 26 type ligand sequence G description binding site for residue 947 B 401 source : AC2 6) chain B residue 27 type ligand sequence T description binding site for residue 947 B 401 source : AC2 7) chain B residue 28 type ligand sequence G description binding site for residue 947 B 401 source : AC2 8) chain B residue 29 type ligand sequence E description binding site for residue 947 B 401 source : AC2 9) chain B residue 30 type ligand sequence L description binding site for residue 947 B 401 source : AC2 10) chain B residue 31 type ligand sequence T description binding site for residue 947 B 401 source : AC2 11) chain B residue 16-18 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence FVM description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 12) chain B residue 20-22 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence EGR description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 13) chain B residue 24 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence A description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 14) chain B residue 26-31 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence GTGELT description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 15) chain B residue 34 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence L description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 16) chain B residue 113 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence Y description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 17) chain B residue 177-179 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence MDC description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_B_401 18) chain B residue 27-28 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence TG description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_D_401 19) chain B residue 31-32 type binding ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide sequence TQ description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site source pdb_hetatom : 947_5pzt_D_401

Display surface Download Links