eF-site ID 5pzt-ABCDEFGH
PDB Code 5pzt
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3-ethyl-4-phenylphenyl)sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAI
IVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKS
TDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNC
FMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAV
TEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFL
YPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVL
DVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAI
IVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKS
TDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNC
FMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAV
TEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFL
YPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVL
DVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIV
EPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTD
EPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFM
LDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTE
YIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYP
ANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDV
IPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 20
type
ligand
sequence E
description binding site for residue 947 A 401
source : AC1

2) chain A
residue 21
type
ligand
sequence G
description binding site for residue 947 A 401
source : AC1

3) chain A
residue 22
type
ligand
sequence R
description binding site for residue 947 A 401
source : AC1

4) chain A
residue 26
type
ligand
sequence G
description binding site for residue 947 A 401
source : AC1

5) chain A
residue 27
type
ligand
sequence T
description binding site for residue 947 A 401
source : AC1

6) chain A
residue 28
type
ligand
sequence G
description binding site for residue 947 A 401
source : AC1

7) chain A
residue 30
type
ligand
sequence L
description binding site for residue 947 A 401
source : AC1

8) chain A
residue 31
type
ligand
sequence T
description binding site for residue 947 A 401
source : AC1

9) chain A
residue 34
type
ligand
sequence L
description binding site for residue 947 A 401
source : AC1

10) chain A
residue 177
type
ligand
sequence M
description binding site for residue 947 A 401
source : AC1

11) chain A
residue 179
type
ligand
sequence C
description binding site for residue 947 A 401
source : AC1

12) chain B
residue 17
type
ligand
sequence V
description binding site for residue 947 B 401
source : AC2

13) chain B
residue 20
type
ligand
sequence E
description binding site for residue 947 B 401
source : AC2

14) chain B
residue 21
type
ligand
sequence G
description binding site for residue 947 B 401
source : AC2

15) chain B
residue 22
type
ligand
sequence R
description binding site for residue 947 B 401
source : AC2

16) chain B
residue 26
type
ligand
sequence G
description binding site for residue 947 B 401
source : AC2

17) chain B
residue 27
type
ligand
sequence T
description binding site for residue 947 B 401
source : AC2

18) chain B
residue 28
type
ligand
sequence G
description binding site for residue 947 B 401
source : AC2

19) chain B
residue 29
type
ligand
sequence E
description binding site for residue 947 B 401
source : AC2

20) chain B
residue 30
type
ligand
sequence L
description binding site for residue 947 B 401
source : AC2

21) chain B
residue 31
type
ligand
sequence T
description binding site for residue 947 B 401
source : AC2

22) chain D
residue 27
type
ligand
sequence T
description binding site for residue 947 B 401
source : AC2

23) chain A
residue 27
type
ligand
sequence T
description binding site for residue 947 C 401
source : AC3

24) chain C
residue 17
type
ligand
sequence V
description binding site for residue 947 C 401
source : AC3

25) chain C
residue 20
type
ligand
sequence E
description binding site for residue 947 C 401
source : AC3

26) chain C
residue 21
type
ligand
sequence G
description binding site for residue 947 C 401
source : AC3

27) chain C
residue 22
type
ligand
sequence R
description binding site for residue 947 C 401
source : AC3

28) chain C
residue 24
type
ligand
sequence A
description binding site for residue 947 C 401
source : AC3

29) chain C
residue 26
type
ligand
sequence G
description binding site for residue 947 C 401
source : AC3

30) chain C
residue 27
type
ligand
sequence T
description binding site for residue 947 C 401
source : AC3

31) chain C
residue 28
type
ligand
sequence G
description binding site for residue 947 C 401
source : AC3

32) chain C
residue 29
type
ligand
sequence E
description binding site for residue 947 C 401
source : AC3

33) chain C
residue 30
type
ligand
sequence L
description binding site for residue 947 C 401
source : AC3

34) chain C
residue 31
type
ligand
sequence T
description binding site for residue 947 C 401
source : AC3

35) chain D
residue 17
type
ligand
sequence V
description binding site for residue 947 D 401
source : AC4

36) chain D
residue 20
type
ligand
sequence E
description binding site for residue 947 D 401
source : AC4

37) chain D
residue 21
type
ligand
sequence G
description binding site for residue 947 D 401
source : AC4

38) chain D
residue 22
type
ligand
sequence R
description binding site for residue 947 D 401
source : AC4

39) chain D
residue 24
type
ligand
sequence A
description binding site for residue 947 D 401
source : AC4

40) chain D
residue 26
type
ligand
sequence G
description binding site for residue 947 D 401
source : AC4

41) chain D
residue 27
type
ligand
sequence T
description binding site for residue 947 D 401
source : AC4

42) chain D
residue 28
type
ligand
sequence G
description binding site for residue 947 D 401
source : AC4

43) chain D
residue 29
type
ligand
sequence E
description binding site for residue 947 D 401
source : AC4

44) chain D
residue 30
type
ligand
sequence L
description binding site for residue 947 D 401
source : AC4

45) chain D
residue 31
type
ligand
sequence T
description binding site for residue 947 D 401
source : AC4

46) chain D
residue 177
type
ligand
sequence M
description binding site for residue 947 D 401
source : AC4

47) chain E
residue 17
type
ligand
sequence V
description binding site for residue 947 E 401
source : AC5

48) chain E
residue 20
type
ligand
sequence E
description binding site for residue 947 E 401
source : AC5

49) chain E
residue 21
type
ligand
sequence G
description binding site for residue 947 E 401
source : AC5

50) chain E
residue 22
type
ligand
sequence R
description binding site for residue 947 E 401
source : AC5

51) chain E
residue 26
type
ligand
sequence G
description binding site for residue 947 E 401
source : AC5

52) chain E
residue 28
type
ligand
sequence G
description binding site for residue 947 E 401
source : AC5

53) chain E
residue 29
type
ligand
sequence E
description binding site for residue 947 E 401
source : AC5

54) chain E
residue 30
type
ligand
sequence L
description binding site for residue 947 E 401
source : AC5

55) chain E
residue 31
type
ligand
sequence T
description binding site for residue 947 E 401
source : AC5

56) chain E
residue 179
type
ligand
sequence C
description binding site for residue 947 E 401
source : AC5

57) chain F
residue 17
type
ligand
sequence V
description binding site for residue 947 F 401
source : AC6

58) chain F
residue 18
type
ligand
sequence M
description binding site for residue 947 F 401
source : AC6

59) chain F
residue 20
type
ligand
sequence E
description binding site for residue 947 F 401
source : AC6

60) chain F
residue 21
type
ligand
sequence G
description binding site for residue 947 F 401
source : AC6

61) chain F
residue 22
type
ligand
sequence R
description binding site for residue 947 F 401
source : AC6

62) chain F
residue 26
type
ligand
sequence G
description binding site for residue 947 F 401
source : AC6

63) chain F
residue 27
type
ligand
sequence T
description binding site for residue 947 F 401
source : AC6

64) chain F
residue 28
type
ligand
sequence G
description binding site for residue 947 F 401
source : AC6

65) chain F
residue 29
type
ligand
sequence E
description binding site for residue 947 F 401
source : AC6

66) chain F
residue 30
type
ligand
sequence L
description binding site for residue 947 F 401
source : AC6

67) chain F
residue 31
type
ligand
sequence T
description binding site for residue 947 F 401
source : AC6

68) chain G
residue 17
type
ligand
sequence V
description binding site for residue 947 G 401
source : AC7

69) chain G
residue 18
type
ligand
sequence M
description binding site for residue 947 G 401
source : AC7

70) chain G
residue 20
type
ligand
sequence E
description binding site for residue 947 G 401
source : AC7

71) chain G
residue 21
type
ligand
sequence G
description binding site for residue 947 G 401
source : AC7

72) chain G
residue 22
type
ligand
sequence R
description binding site for residue 947 G 401
source : AC7

73) chain G
residue 26
type
ligand
sequence G
description binding site for residue 947 G 401
source : AC7

74) chain G
residue 27
type
ligand
sequence T
description binding site for residue 947 G 401
source : AC7

75) chain G
residue 28
type
ligand
sequence G
description binding site for residue 947 G 401
source : AC7

76) chain G
residue 29
type
ligand
sequence E
description binding site for residue 947 G 401
source : AC7

77) chain G
residue 30
type
ligand
sequence L
description binding site for residue 947 G 401
source : AC7

78) chain G
residue 31
type
ligand
sequence T
description binding site for residue 947 G 401
source : AC7

79) chain G
residue 177
type
ligand
sequence M
description binding site for residue 947 G 401
source : AC7

80) chain F
residue 27
type
ligand
sequence T
description binding site for residue 947 H 401
source : AC8

81) chain H
residue 17
type
ligand
sequence V
description binding site for residue 947 H 401
source : AC8

82) chain H
residue 20
type
ligand
sequence E
description binding site for residue 947 H 401
source : AC8

83) chain H
residue 21
type
ligand
sequence G
description binding site for residue 947 H 401
source : AC8

84) chain H
residue 22
type
ligand
sequence R
description binding site for residue 947 H 401
source : AC8

85) chain H
residue 26
type
ligand
sequence G
description binding site for residue 947 H 401
source : AC8

86) chain H
residue 27
type
ligand
sequence T
description binding site for residue 947 H 401
source : AC8

87) chain H
residue 28
type
ligand
sequence G
description binding site for residue 947 H 401
source : AC8

88) chain H
residue 29
type
ligand
sequence E
description binding site for residue 947 H 401
source : AC8

89) chain H
residue 30
type
ligand
sequence L
description binding site for residue 947 H 401
source : AC8

90) chain H
residue 31
type
ligand
sequence T
description binding site for residue 947 H 401
source : AC8

91) chain A
residue 17-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

92) chain A
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

93) chain A
residue 24-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

94) chain A
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

95) chain A
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

96) chain A
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

97) chain C
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

98) chain C
residue 31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_A_401

99) chain A
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

100) chain A
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

101) chain C
residue 16-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

102) chain C
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

103) chain C
residue 24-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

104) chain C
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

105) chain C
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

106) chain C
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_C_401

107) chain B
residue 16-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

108) chain B
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

109) chain B
residue 24
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

110) chain B
residue 26-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

111) chain B
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

112) chain B
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

113) chain B
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

114) chain D
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

115) chain D
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_B_401

116) chain B
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

117) chain B
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

118) chain D
residue 16-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

119) chain D
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

120) chain D
residue 24-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

121) chain D
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

122) chain D
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

123) chain D
residue 177
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

124) chain D
residue 179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence C
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_D_401

125) chain E
residue 17-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

126) chain E
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

127) chain E
residue 24-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELTQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

128) chain E
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

129) chain E
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

130) chain E
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

131) chain G
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

132) chain G
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_E_401

133) chain E
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

134) chain E
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

135) chain G
residue 17-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

136) chain G
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

137) chain G
residue 24-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

138) chain G
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

139) chain G
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

140) chain G
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_G_401

141) chain F
residue 17-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

142) chain F
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

143) chain F
residue 24-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

144) chain F
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

145) chain F
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

146) chain F
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

147) chain H
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

148) chain H
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_F_401

149) chain F
residue 27-28
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

150) chain F
residue 31-32
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

151) chain H
residue 16-18
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence FVM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

152) chain H
residue 20-22
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

153) chain H
residue 24-31
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

154) chain H
residue 34
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence L
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

155) chain H
residue 113
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401

156) chain H
residue 177-179
type binding
ligand 947: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide
sequence MDC
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-2-ethyl[1,1'-biphenyl]-4-sulfonamide binding site
source pdb_hetatom : 947_5pzt_H_401


Display surface

Download
Links