eF-site ID 5pzs-B PDB Code 5pzs Chain B click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[6-[(3-chlorophenyl)sulfonylcarbamoylamino]hexyl]urea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description Functional site 1) chain B residue 17 type sequence V description binding site for residue 93Y B 401 source : AC2 2) chain B residue 18 type sequence M description binding site for residue 93Y B 401 source : AC2 3) chain B residue 21 type sequence G description binding site for residue 93Y B 401 source : AC2 4) chain B residue 24 type sequence A description binding site for residue 93Y B 401 source : AC2 5) chain B residue 26 type sequence G description binding site for residue 93Y B 401 source : AC2 6) chain B residue 27 type sequence T description binding site for residue 93Y B 401 source : AC2 7) chain B residue 28 type sequence G description binding site for residue 93Y B 401 source : AC2 8) chain B residue 29 type sequence E description binding site for residue 93Y B 401 source : AC2 9) chain B residue 30 type sequence L description binding site for residue 93Y B 401 source : AC2 10) chain B residue 31 type sequence T description binding site for residue 93Y B 401 source : AC2

Display surface Download Links