eF-site ID 5pzs-B PDB Code 5pzs Chain B click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[6-[(3-chlorophenyl)sulfonylcarbamoylamino]hexyl]urea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain B residue 17 type ligand sequence V description binding site for residue 93Y B 401 source : AC2 2) chain B residue 18 type ligand sequence M description binding site for residue 93Y B 401 source : AC2 3) chain B residue 21 type ligand sequence G description binding site for residue 93Y B 401 source : AC2 4) chain B residue 24 type ligand sequence A description binding site for residue 93Y B 401 source : AC2 5) chain B residue 26 type ligand sequence G description binding site for residue 93Y B 401 source : AC2 6) chain B residue 27 type ligand sequence T description binding site for residue 93Y B 401 source : AC2 7) chain B residue 28 type ligand sequence G description binding site for residue 93Y B 401 source : AC2 8) chain B residue 29 type ligand sequence E description binding site for residue 93Y B 401 source : AC2 9) chain B residue 30 type ligand sequence L description binding site for residue 93Y B 401 source : AC2 10) chain B residue 31 type ligand sequence T description binding site for residue 93Y B 401 source : AC2 11) chain B residue 17-18 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401 12) chain B residue 20-22 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401 13) chain B residue 24 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401 14) chain B residue 26-31 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401 15) chain B residue 34 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401 16) chain B residue 113 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401 17) chain B residue 177 type binding ligand 93Y: N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-(hexane-1,6-diyldicarbamoyl)bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93Y_5pzs_B_401

Display surface Download Links