eF-site ID 5pzr-D PDB Code 5pzr Chain D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[3-[3-[(3-chlorophenyl)sulfonylcarbamoylamino]propoxy]propyl]urea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description Functional site 1) chain D residue 17 type sequence V description binding site for residue 93S B 401 source : AC2 2) chain D residue 18 type sequence M description binding site for residue 93S B 401 source : AC2 3) chain D residue 21 type sequence G description binding site for residue 93S B 401 source : AC2 4) chain D residue 22 type sequence R description binding site for residue 93S B 401 source : AC2 5) chain D residue 26 type sequence G description binding site for residue 93S B 401 source : AC2 6) chain D residue 27 type sequence T description binding site for residue 93S B 401 source : AC2 7) chain D residue 28 type sequence G description binding site for residue 93S B 401 source : AC2 8) chain D residue 29 type sequence E description binding site for residue 93S B 401 source : AC2 9) chain D residue 30 type sequence L description binding site for residue 93S B 401 source : AC2 10) chain D residue 31 type sequence T description binding site for residue 93S B 401 source : AC2

Display surface Download Links