eF-site ID 5pzr-D PDB Code 5pzr Chain D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[3-[3-[(3-chlorophenyl)sulfonylcarbamoylamino]propoxy]propyl]urea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain D residue 17 type ligand sequence V description binding site for residue 93S B 401 source : AC2 2) chain D residue 18 type ligand sequence M description binding site for residue 93S B 401 source : AC2 3) chain D residue 21 type ligand sequence G description binding site for residue 93S B 401 source : AC2 4) chain D residue 22 type ligand sequence R description binding site for residue 93S B 401 source : AC2 5) chain D residue 26 type ligand sequence G description binding site for residue 93S B 401 source : AC2 6) chain D residue 27 type ligand sequence T description binding site for residue 93S B 401 source : AC2 7) chain D residue 28 type ligand sequence G description binding site for residue 93S B 401 source : AC2 8) chain D residue 29 type ligand sequence E description binding site for residue 93S B 401 source : AC2 9) chain D residue 30 type ligand sequence L description binding site for residue 93S B 401 source : AC2 10) chain D residue 31 type ligand sequence T description binding site for residue 93S B 401 source : AC2 11) chain D residue 17-18 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 12) chain D residue 20-22 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 13) chain D residue 24 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 14) chain D residue 26-31 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 15) chain D residue 34 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 16) chain D residue 113 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 17) chain D residue 177 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401

Display surface Download Links