eF-site ID 5pzr-C PDB Code 5pzr Chain C click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[3-[3-[(3-chlorophenyl)sulfonylcarbamoylamino]propoxy]propyl]urea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain C residue 17 type ligand sequence V description binding site for residue 93S A 401 source : AC1 2) chain C residue 18 type ligand sequence M description binding site for residue 93S A 401 source : AC1 3) chain C residue 21 type ligand sequence G description binding site for residue 93S A 401 source : AC1 4) chain C residue 22 type ligand sequence R description binding site for residue 93S A 401 source : AC1 5) chain C residue 26 type ligand sequence G description binding site for residue 93S A 401 source : AC1 6) chain C residue 27 type ligand sequence T description binding site for residue 93S A 401 source : AC1 7) chain C residue 28 type ligand sequence G description binding site for residue 93S A 401 source : AC1 8) chain C residue 29 type ligand sequence E description binding site for residue 93S A 401 source : AC1 9) chain C residue 30 type ligand sequence L description binding site for residue 93S A 401 source : AC1 10) chain C residue 31 type ligand sequence T description binding site for residue 93S A 401 source : AC1 11) chain C residue 177 type ligand sequence M description binding site for residue 93S A 401 source : AC1 12) chain C residue 17-18 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 13) chain C residue 20-22 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 14) chain C residue 24 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 15) chain C residue 26-31 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 16) chain C residue 34 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 17) chain C residue 113 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 18) chain C residue 177 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401

Display surface Download Links