eF-site ID 5pzr-C
PDB Code 5pzr
Chain C

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[3-[3-[(3-chlorophenyl)sulfonylcarbamoylamino]propoxy]propyl]urea
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain C
residue 17
type
ligand
sequence V
description binding site for residue 93S A 401
source : AC1

2) chain C
residue 18
type
ligand
sequence M
description binding site for residue 93S A 401
source : AC1

3) chain C
residue 21
type
ligand
sequence G
description binding site for residue 93S A 401
source : AC1

4) chain C
residue 22
type
ligand
sequence R
description binding site for residue 93S A 401
source : AC1

5) chain C
residue 26
type
ligand
sequence G
description binding site for residue 93S A 401
source : AC1

6) chain C
residue 27
type
ligand
sequence T
description binding site for residue 93S A 401
source : AC1

7) chain C
residue 28
type
ligand
sequence G
description binding site for residue 93S A 401
source : AC1

8) chain C
residue 29
type
ligand
sequence E
description binding site for residue 93S A 401
source : AC1

9) chain C
residue 30
type
ligand
sequence L
description binding site for residue 93S A 401
source : AC1

10) chain C
residue 31
type
ligand
sequence T
description binding site for residue 93S A 401
source : AC1

11) chain C
residue 177
type
ligand
sequence M
description binding site for residue 93S A 401
source : AC1

12) chain C
residue 17-18
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence VM
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401

13) chain C
residue 20-22
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence EGR
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401

14) chain C
residue 24
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence A
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401

15) chain C
residue 26-31
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence GTGELT
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401

16) chain C
residue 34
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence L
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401

17) chain C
residue 113
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence Y
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401

18) chain C
residue 177
type binding
ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide)
sequence M
description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site
source pdb_hetatom : 93S_5pzr_A_401


Display surface

Download
Links