eF-site ID 5pzr-ABCD PDB Code 5pzr Chain A, B, C, D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(3-chlorophenyl)sulfonyl-3-[3-[3-[(3-chlorophenyl)sulfonylcarbamoylamino]propoxy]propyl]urea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 93S A 401 source : AC1 2) chain A residue 18 type ligand sequence M description binding site for residue 93S A 401 source : AC1 3) chain A residue 21 type ligand sequence G description binding site for residue 93S A 401 source : AC1 4) chain A residue 22 type ligand sequence R description binding site for residue 93S A 401 source : AC1 5) chain A residue 26 type ligand sequence G description binding site for residue 93S A 401 source : AC1 6) chain A residue 27 type ligand sequence T description binding site for residue 93S A 401 source : AC1 7) chain A residue 28 type ligand sequence G description binding site for residue 93S A 401 source : AC1 8) chain A residue 29 type ligand sequence E description binding site for residue 93S A 401 source : AC1 9) chain A residue 30 type ligand sequence L description binding site for residue 93S A 401 source : AC1 10) chain A residue 31 type ligand sequence T description binding site for residue 93S A 401 source : AC1 11) chain A residue 177 type ligand sequence M description binding site for residue 93S A 401 source : AC1 12) chain C residue 17 type ligand sequence V description binding site for residue 93S A 401 source : AC1 13) chain C residue 18 type ligand sequence M description binding site for residue 93S A 401 source : AC1 14) chain C residue 21 type ligand sequence G description binding site for residue 93S A 401 source : AC1 15) chain C residue 22 type ligand sequence R description binding site for residue 93S A 401 source : AC1 16) chain C residue 26 type ligand sequence G description binding site for residue 93S A 401 source : AC1 17) chain C residue 27 type ligand sequence T description binding site for residue 93S A 401 source : AC1 18) chain C residue 28 type ligand sequence G description binding site for residue 93S A 401 source : AC1 19) chain C residue 29 type ligand sequence E description binding site for residue 93S A 401 source : AC1 20) chain C residue 30 type ligand sequence L description binding site for residue 93S A 401 source : AC1 21) chain C residue 31 type ligand sequence T description binding site for residue 93S A 401 source : AC1 22) chain C residue 177 type ligand sequence M description binding site for residue 93S A 401 source : AC1 23) chain B residue 17 type ligand sequence V description binding site for residue 93S B 401 source : AC2 24) chain B residue 21 type ligand sequence G description binding site for residue 93S B 401 source : AC2 25) chain B residue 22 type ligand sequence R description binding site for residue 93S B 401 source : AC2 26) chain B residue 26 type ligand sequence G description binding site for residue 93S B 401 source : AC2 27) chain B residue 27 type ligand sequence T description binding site for residue 93S B 401 source : AC2 28) chain B residue 28 type ligand sequence G description binding site for residue 93S B 401 source : AC2 29) chain B residue 29 type ligand sequence E description binding site for residue 93S B 401 source : AC2 30) chain B residue 30 type ligand sequence L description binding site for residue 93S B 401 source : AC2 31) chain B residue 31 type ligand sequence T description binding site for residue 93S B 401 source : AC2 32) chain D residue 17 type ligand sequence V description binding site for residue 93S B 401 source : AC2 33) chain D residue 18 type ligand sequence M description binding site for residue 93S B 401 source : AC2 34) chain D residue 21 type ligand sequence G description binding site for residue 93S B 401 source : AC2 35) chain D residue 22 type ligand sequence R description binding site for residue 93S B 401 source : AC2 36) chain D residue 26 type ligand sequence G description binding site for residue 93S B 401 source : AC2 37) chain D residue 27 type ligand sequence T description binding site for residue 93S B 401 source : AC2 38) chain D residue 28 type ligand sequence G description binding site for residue 93S B 401 source : AC2 39) chain D residue 29 type ligand sequence E description binding site for residue 93S B 401 source : AC2 40) chain D residue 30 type ligand sequence L description binding site for residue 93S B 401 source : AC2 41) chain D residue 31 type ligand sequence T description binding site for residue 93S B 401 source : AC2 42) chain A residue 17-18 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 43) chain A residue 20-22 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 44) chain A residue 24 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 45) chain A residue 26-31 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 46) chain A residue 34 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 47) chain A residue 113 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 48) chain A residue 177 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 49) chain C residue 17-18 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 50) chain C residue 20-22 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 51) chain C residue 24 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 52) chain C residue 26-31 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 53) chain C residue 34 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 54) chain C residue 113 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 55) chain C residue 177 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_A_401 56) chain B residue 17-18 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 57) chain B residue 20-22 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 58) chain B residue 24 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 59) chain B residue 26-31 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 60) chain B residue 34 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 61) chain B residue 113 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 62) chain B residue 177 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 63) chain D residue 17-18 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence VM description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 64) chain D residue 20-22 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence EGR description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 65) chain D residue 24 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence A description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 66) chain D residue 26-31 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence GTGELT description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 67) chain D residue 34 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence L description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 68) chain D residue 113 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence Y description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401 69) chain D residue 177 type binding ligand 93S: N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) sequence M description N,N'-{oxybis[(propane-3,1-diyl)carbamoyl]}bis(3-chlorobenzene-1-sulfonamide) binding site source pdb_hetatom : 93S_5pzr_B_401

Display surface Download Links