eF-site ID 5pzq-D PDB Code 5pzq Chain D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain D residue 26 type ligand sequence G description binding site for residue 93V C 401 source : AC3 2) chain D residue 17 type ligand sequence V description binding site for residue 93V D 401 source : AC4 3) chain D residue 20 type ligand sequence E description binding site for residue 93V D 401 source : AC4 4) chain D residue 21 type ligand sequence G description binding site for residue 93V D 401 source : AC4 5) chain D residue 24 type ligand sequence A description binding site for residue 93V D 401 source : AC4 6) chain D residue 26 type ligand sequence G description binding site for residue 93V D 401 source : AC4 7) chain D residue 27 type ligand sequence T description binding site for residue 93V D 401 source : AC4 8) chain D residue 28 type ligand sequence G description binding site for residue 93V D 401 source : AC4 9) chain D residue 29 type ligand sequence E description binding site for residue 93V D 401 source : AC4 10) chain D residue 30 type ligand sequence L description binding site for residue 93V D 401 source : AC4 11) chain D residue 31 type ligand sequence T description binding site for residue 93V D 401 source : AC4 12) chain D residue 34 type ligand sequence L description binding site for residue 93V D 401 source : AC4 13) chain D residue 112 type ligand sequence K description binding site for residue 93V D 401 source : AC4 14) chain D residue 113 type ligand sequence Y description binding site for residue 93V D 401 source : AC4 15) chain D residue 177 type ligand sequence M description binding site for residue 93V D 401 source : AC4 16) chain D residue 17 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence V description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 17) chain D residue 20-21 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence EG description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 18) chain D residue 24 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence A description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 19) chain D residue 26-31 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence GTGELT description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 20) chain D residue 34 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence L description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 21) chain D residue 112-113 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence KY description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 22) chain D residue 140 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence R description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401 23) chain D residue 177 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence M description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_D_401

Display surface Download Links