eF-site ID 5pzq-D
PDB Code 5pzq
Chain D

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain D
residue 26
type
ligand
sequence G
description binding site for residue 93V C 401
source : AC3

2) chain D
residue 17
type
ligand
sequence V
description binding site for residue 93V D 401
source : AC4

3) chain D
residue 20
type
ligand
sequence E
description binding site for residue 93V D 401
source : AC4

4) chain D
residue 21
type
ligand
sequence G
description binding site for residue 93V D 401
source : AC4

5) chain D
residue 24
type
ligand
sequence A
description binding site for residue 93V D 401
source : AC4

6) chain D
residue 26
type
ligand
sequence G
description binding site for residue 93V D 401
source : AC4

7) chain D
residue 27
type
ligand
sequence T
description binding site for residue 93V D 401
source : AC4

8) chain D
residue 28
type
ligand
sequence G
description binding site for residue 93V D 401
source : AC4

9) chain D
residue 29
type
ligand
sequence E
description binding site for residue 93V D 401
source : AC4

10) chain D
residue 30
type
ligand
sequence L
description binding site for residue 93V D 401
source : AC4

11) chain D
residue 31
type
ligand
sequence T
description binding site for residue 93V D 401
source : AC4

12) chain D
residue 34
type
ligand
sequence L
description binding site for residue 93V D 401
source : AC4

13) chain D
residue 112
type
ligand
sequence K
description binding site for residue 93V D 401
source : AC4

14) chain D
residue 113
type
ligand
sequence Y
description binding site for residue 93V D 401
source : AC4

15) chain D
residue 177
type
ligand
sequence M
description binding site for residue 93V D 401
source : AC4

16) chain D
residue 17
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence V
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

17) chain D
residue 20-21
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence EG
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

18) chain D
residue 24
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence A
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

19) chain D
residue 26-31
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence GTGELT
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

20) chain D
residue 34
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence L
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

21) chain D
residue 112-113
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence KY
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

22) chain D
residue 140
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence R
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401

23) chain D
residue 177
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence M
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_D_401


Display surface

Download
Links