eF-site ID 5pzq-C
PDB Code 5pzq
Chain C

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain C
residue 20
type
ligand
sequence E
description binding site for residue 93V C 401
source : AC3

2) chain C
residue 21
type
ligand
sequence G
description binding site for residue 93V C 401
source : AC3

3) chain C
residue 24
type
ligand
sequence A
description binding site for residue 93V C 401
source : AC3

4) chain C
residue 26
type
ligand
sequence G
description binding site for residue 93V C 401
source : AC3

5) chain C
residue 27
type
ligand
sequence T
description binding site for residue 93V C 401
source : AC3

6) chain C
residue 28
type
ligand
sequence G
description binding site for residue 93V C 401
source : AC3

7) chain C
residue 29
type
ligand
sequence E
description binding site for residue 93V C 401
source : AC3

8) chain C
residue 30
type
ligand
sequence L
description binding site for residue 93V C 401
source : AC3

9) chain C
residue 31
type
ligand
sequence T
description binding site for residue 93V C 401
source : AC3

10) chain C
residue 34
type
ligand
sequence L
description binding site for residue 93V C 401
source : AC3

11) chain C
residue 112
type
ligand
sequence K
description binding site for residue 93V C 401
source : AC3

12) chain C
residue 113
type
ligand
sequence Y
description binding site for residue 93V C 401
source : AC3

13) chain C
residue 140
type
ligand
sequence R
description binding site for residue 93V C 401
source : AC3

14) chain C
residue 177
type
ligand
sequence M
description binding site for residue 93V C 401
source : AC3

15) chain C
residue 17
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence V
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

16) chain C
residue 20-21
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence EG
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

17) chain C
residue 24
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence A
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

18) chain C
residue 26-31
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence GTGELT
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

19) chain C
residue 34
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence L
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

20) chain C
residue 112-113
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence KY
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

21) chain C
residue 140
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence R
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401

22) chain C
residue 177
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence M
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_C_401


Display surface

Download
Links