eF-site ID 5pzq-C PDB Code 5pzq Chain C click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain C residue 20 type ligand sequence E description binding site for residue 93V C 401 source : AC3 2) chain C residue 21 type ligand sequence G description binding site for residue 93V C 401 source : AC3 3) chain C residue 24 type ligand sequence A description binding site for residue 93V C 401 source : AC3 4) chain C residue 26 type ligand sequence G description binding site for residue 93V C 401 source : AC3 5) chain C residue 27 type ligand sequence T description binding site for residue 93V C 401 source : AC3 6) chain C residue 28 type ligand sequence G description binding site for residue 93V C 401 source : AC3 7) chain C residue 29 type ligand sequence E description binding site for residue 93V C 401 source : AC3 8) chain C residue 30 type ligand sequence L description binding site for residue 93V C 401 source : AC3 9) chain C residue 31 type ligand sequence T description binding site for residue 93V C 401 source : AC3 10) chain C residue 34 type ligand sequence L description binding site for residue 93V C 401 source : AC3 11) chain C residue 112 type ligand sequence K description binding site for residue 93V C 401 source : AC3 12) chain C residue 113 type ligand sequence Y description binding site for residue 93V C 401 source : AC3 13) chain C residue 140 type ligand sequence R description binding site for residue 93V C 401 source : AC3 14) chain C residue 177 type ligand sequence M description binding site for residue 93V C 401 source : AC3 15) chain C residue 17 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence V description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 16) chain C residue 20-21 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence EG description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 17) chain C residue 24 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence A description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 18) chain C residue 26-31 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence GTGELT description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 19) chain C residue 34 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence L description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 20) chain C residue 112-113 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence KY description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 21) chain C residue 140 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence R description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401 22) chain C residue 177 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence M description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_C_401

Display surface Download Links