eF-site ID 5pzq-A
PDB Code 5pzq
Chain A

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
Classification HYDROLASE/HYDROLASE inhibitor
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE
EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG
IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM
DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK
DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT
GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 17
type
ligand
sequence V
description binding site for residue 93V A 401
source : AC1

2) chain A
residue 20
type
ligand
sequence E
description binding site for residue 93V A 401
source : AC1

3) chain A
residue 21
type
ligand
sequence G
description binding site for residue 93V A 401
source : AC1

4) chain A
residue 24
type
ligand
sequence A
description binding site for residue 93V A 401
source : AC1

5) chain A
residue 26
type
ligand
sequence G
description binding site for residue 93V A 401
source : AC1

6) chain A
residue 27
type
ligand
sequence T
description binding site for residue 93V A 401
source : AC1

7) chain A
residue 28
type
ligand
sequence G
description binding site for residue 93V A 401
source : AC1

8) chain A
residue 29
type
ligand
sequence E
description binding site for residue 93V A 401
source : AC1

9) chain A
residue 30
type
ligand
sequence L
description binding site for residue 93V A 401
source : AC1

10) chain A
residue 34
type
ligand
sequence L
description binding site for residue 93V A 401
source : AC1

11) chain A
residue 112
type
ligand
sequence K
description binding site for residue 93V A 401
source : AC1

12) chain A
residue 113
type
ligand
sequence Y
description binding site for residue 93V A 401
source : AC1

13) chain A
residue 140
type
ligand
sequence R
description binding site for residue 93V A 401
source : AC1

14) chain A
residue 25
type
ligand
sequence R
description binding site for residue 93V B 401
source : AC2

15) chain A
residue 17
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence V
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

16) chain A
residue 20-21
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence EG
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

17) chain A
residue 24
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence A
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

18) chain A
residue 26-31
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence GTGELT
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

19) chain A
residue 34
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence L
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

20) chain A
residue 112-113
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence KY
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

21) chain A
residue 140
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence R
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401

22) chain A
residue 177
type binding
ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid
sequence M
description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site
source pdb_hetatom : 93V_5pzq_A_401


Display surface

Download
Links