eF-site ID 5pzq-A PDB Code 5pzq Chain A click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 93V A 401 source : AC1 2) chain A residue 20 type ligand sequence E description binding site for residue 93V A 401 source : AC1 3) chain A residue 21 type ligand sequence G description binding site for residue 93V A 401 source : AC1 4) chain A residue 24 type ligand sequence A description binding site for residue 93V A 401 source : AC1 5) chain A residue 26 type ligand sequence G description binding site for residue 93V A 401 source : AC1 6) chain A residue 27 type ligand sequence T description binding site for residue 93V A 401 source : AC1 7) chain A residue 28 type ligand sequence G description binding site for residue 93V A 401 source : AC1 8) chain A residue 29 type ligand sequence E description binding site for residue 93V A 401 source : AC1 9) chain A residue 30 type ligand sequence L description binding site for residue 93V A 401 source : AC1 10) chain A residue 34 type ligand sequence L description binding site for residue 93V A 401 source : AC1 11) chain A residue 112 type ligand sequence K description binding site for residue 93V A 401 source : AC1 12) chain A residue 113 type ligand sequence Y description binding site for residue 93V A 401 source : AC1 13) chain A residue 140 type ligand sequence R description binding site for residue 93V A 401 source : AC1 14) chain A residue 25 type ligand sequence R description binding site for residue 93V B 401 source : AC2 15) chain A residue 17 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence V description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 16) chain A residue 20-21 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence EG description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 17) chain A residue 24 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence A description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 18) chain A residue 26-31 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence GTGELT description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 19) chain A residue 34 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence L description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 20) chain A residue 112-113 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence KY description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 21) chain A residue 140 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence R description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401 22) chain A residue 177 type binding ligand 93V: 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid sequence M description 2-(4-methoxyphenyl)furan-3,4-dicarboxylic acid binding site source pdb_hetatom : 93V_5pzq_A_401

Display surface Download Links