eF-site ID 5ovt-D PDB Code 5ovt Chain D Title Thiobacillus denitrificans BPH in complex with Epoxomicin Classification HYDROLASE Compound BPH Source (5OVT) Sequence D:  TTVTIVRKDGRIAIAADTLTKWGGGKESADYVANHEKIIR VGDSYVAITGSATFKLILADYFASLDEPPQLDSVARIFCV WNTLHGALKEHYYLQDLESSRXDVLIANPRGIFGVAAHRT VQEFSKFYAYGSGSPYALGAXYAAYRAPSLDAEAVARLGV XAAAEFHDESGLPVQSFVXELSP Description Functional site 1) chain D residue 1 type sequence T description binding site for residue PO4 d 101 source : AC6 2) chain D residue 49 type sequence T description binding site for residue PO4 d 101 source : AC6 3) chain D residue 50 type sequence G description binding site for residue PO4 d 101 source : AC6 4) chain D residue 139 type sequence S description binding site for residue PO4 d 101 source : AC6 5) chain D residue 176 type sequence E description binding site for residue PO4 d 101 source : AC6 6) chain D residue 1 type sequence T description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 7) chain D residue 19 type sequence L description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 8) chain D residue 21 type sequence K description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 9) chain D residue 48 type sequence I description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 10) chain D residue 50 type sequence G description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 11) chain D residue 52 type sequence A description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 12) chain D residue 176 type sequence E description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD5 13) chain D residue 1 type sequence T description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 14) chain D residue 19 type sequence L description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 15) chain D residue 21 type sequence K description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 16) chain D residue 48 type sequence I description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 17) chain D residue 50 type sequence G description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 18) chain D residue 52 type sequence A description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 19) chain D residue 176 type sequence E description binding site for Ligand 6VO d 5 bound to THR D 1 source : AD6 20) chain D residue 1 type sequence T description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 21) chain D residue 19 type sequence L description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 22) chain D residue 21 type sequence K description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 23) chain D residue 48 type sequence I description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 24) chain D residue 50 type sequence G description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 25) chain D residue 52 type sequence A description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 26) chain D residue 176 type sequence E description binding site for Ligand 6VO d 5 bound to THR d 4 source : AE7 27) chain D residue 22 type sequence W description binding site for residues ACE d 1 and IML d 2 source : AF8 28) chain D residue 20 type sequence T description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9 29) chain D residue 21 type sequence K description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9 30) chain D residue 22 type sequence W description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9 31) chain D residue 27 type sequence E description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9 32) chain D residue 51 type sequence S description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9 33) chain D residue 52 type sequence A description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9 34) chain D residue 110 type sequence D description binding site for residues ACE e 1 and IML e 2 source : AG1 35) chain D residue 125 type sequence H description binding site for residues ACE e 1 and IML e 2 source : AG1

Display surface Download Links