eF-site ID 5ovt-C PDB Code 5ovt Chain C Title Thiobacillus denitrificans BPH in complex with Epoxomicin Classification HYDROLASE Compound BPH Source (5OVT) Sequence C:  TTVTIVRKDGRIAIAADTLTKWGGGKESADYVANHEKIIR VGDSYVAITGSATFKLILADYFASLDEPPQLDSVARIFCV WNTLHGALKEHYYLQDLESSRXDVLIANPRGIFGVAAHRT VQEFSKFYAYGSGSPYALGAXYAAYRAPSLDAEAVARLGV XAAAEFHDESGLPVQSFVXELSP Description Functional site 1) chain C residue 1 type sequence T description binding site for residue PO4 C 301 source : AC2 2) chain C residue 49 type sequence T description binding site for residue PO4 C 301 source : AC2 3) chain C residue 139 type sequence S description binding site for residue PO4 C 301 source : AC2 4) chain C residue 176 type sequence E description binding site for residue PO4 C 301 source : AC2 5) chain C residue 1 type sequence T description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD3 6) chain C residue 19 type sequence L description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD3 7) chain C residue 50 type sequence G description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD3 8) chain C residue 52 type sequence A description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD3 9) chain C residue 176 type sequence E description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD3 10) chain C residue 1 type sequence T description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD4 11) chain C residue 19 type sequence L description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD4 12) chain C residue 50 type sequence G description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD4 13) chain C residue 52 type sequence A description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD4 14) chain C residue 176 type sequence E description binding site for Ligand 6VO c 5 bound to THR C 1 source : AD4 15) chain C residue 1 type sequence T description binding site for Ligand 6VO c 5 bound to THR c 4 source : AE6 16) chain C residue 19 type sequence L description binding site for Ligand 6VO c 5 bound to THR c 4 source : AE6 17) chain C residue 50 type sequence G description binding site for Ligand 6VO c 5 bound to THR c 4 source : AE6 18) chain C residue 52 type sequence A description binding site for Ligand 6VO c 5 bound to THR c 4 source : AE6 19) chain C residue 176 type sequence E description binding site for Ligand 6VO c 5 bound to THR c 4 source : AE6 20) chain C residue 22 type sequence W description binding site for residues ACE c 1 and IML c 2 source : AF6 21) chain C residue 20 type sequence T description binding site for Di-peptide IML c 2 and ILE c 3 source : AF7 22) chain C residue 21 type sequence K description binding site for Di-peptide IML c 2 and ILE c 3 source : AF7 23) chain C residue 22 type sequence W description binding site for Di-peptide IML c 2 and ILE c 3 source : AF7 24) chain C residue 52 type sequence A description binding site for Di-peptide IML c 2 and ILE c 3 source : AF7 25) chain C residue 125 type sequence H description binding site for residues ACE d 1 and IML d 2 source : AF8 26) chain C residue 129 type sequence Q description binding site for Di-peptide IML d 2 and ILE d 3 source : AF9

Display surface Download Links