eF-site ID 5ovt-B PDB Code 5ovt Chain B Title Thiobacillus denitrificans BPH in complex with Epoxomicin Classification HYDROLASE Compound BPH Source (5OVT) Sequence B:  TTVTIVRKDGRIAIAADTLTKWGGGKESADYVANHEKIIR VGDSYVAITGSATFKLILADYFASLDEPPQLDSVARIFCV WNTLHGALKEHYYLQDLESSRXDVLIANPRGIFGVAAHRT VQEFSKFYAYGSGSPYALGAXYAAYRAPSLDAEAVARLGV XAAAEFHDESGLPVQSFVXELSP Description Functional site 1) chain B residue 1 type sequence T description binding site for residue PO4 b 101 source : AC5 2) chain B residue 49 type sequence T description binding site for residue PO4 b 101 source : AC5 3) chain B residue 50 type sequence G description binding site for residue PO4 b 101 source : AC5 4) chain B residue 138 type sequence G description binding site for residue PO4 b 101 source : AC5 5) chain B residue 139 type sequence S description binding site for residue PO4 b 101 source : AC5 6) chain B residue 1 type sequence T description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD1 7) chain B residue 19 type sequence L description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD1 8) chain B residue 48 type sequence I description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD1 9) chain B residue 50 type sequence G description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD1 10) chain B residue 176 type sequence E description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD1 11) chain B residue 1 type sequence T description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD2 12) chain B residue 19 type sequence L description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD2 13) chain B residue 48 type sequence I description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD2 14) chain B residue 50 type sequence G description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD2 15) chain B residue 176 type sequence E description binding site for Ligand 6VO b 5 bound to THR B 1 source : AD2 16) chain B residue 1 type sequence T description binding site for Ligand 6VO b 5 bound to THR b 4 source : AE5 17) chain B residue 19 type sequence L description binding site for Ligand 6VO b 5 bound to THR b 4 source : AE5 18) chain B residue 48 type sequence I description binding site for Ligand 6VO b 5 bound to THR b 4 source : AE5 19) chain B residue 50 type sequence G description binding site for Ligand 6VO b 5 bound to THR b 4 source : AE5 20) chain B residue 176 type sequence E description binding site for Ligand 6VO b 5 bound to THR b 4 source : AE5 21) chain B residue 22 type sequence W description binding site for residues ACE b 1 and IML b 2 source : AF4 22) chain B residue 20 type sequence T description binding site for Di-peptide IML b 2 and ILE b 3 source : AF5 23) chain B residue 21 type sequence K description binding site for Di-peptide IML b 2 and ILE b 3 source : AF5 24) chain B residue 22 type sequence W description binding site for Di-peptide IML b 2 and ILE b 3 source : AF5 25) chain B residue 51 type sequence S description binding site for Di-peptide IML b 2 and ILE b 3 source : AF5 26) chain B residue 52 type sequence A description binding site for Di-peptide IML b 2 and ILE b 3 source : AF5 27) chain B residue 110 type sequence D description binding site for residues ACE c 1 and IML c 2 source : AF6 28) chain B residue 125 type sequence H description binding site for residues ACE c 1 and IML c 2 source : AF6 29) chain B residue 125 type sequence H description binding site for Di-peptide IML c 2 and ILE c 3 source : AF7

Display surface Download Links