eF-site ID 5omz_19-A
PDB Code 5omz
Model 19
Chain A

click to enlarge
Title Solution structure of domain III (DIII)of Zika virus Envelope protein
Classification VIRAL PROTEIN
Compound Envelope Protein
Source (A0A1V0E2E5_ZIKV)
Sequence A:  MDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG
TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKM
MLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK
Description (1)  Envelope Protein

Display surface

Download
Links