eF-site ID 5olc-H PDB Code 5olc Chain H click to enlarge Title Crystal structure of the 3,6-anhydro-D-galactonate cycloisomerase from Zobellia galactanivorans Classification ISOMERASE Compound Galactonate dehydratase Source Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) (G0L7B8_ZOBGA) Sequence H:  SKIKKIEPYVISHKLDDTRKICIVKITLDDGTYGWGEGYG PAAVIKSGIDFFTPFLLGKEAIGHEVLWQEMYRRSMDYAR SGVLQAAISAIDVALWDIKGKLLNLPVSVLLGGVKNPIIE PYATGLYLEELLVEEALLYKSQGFKATKMKVGLGIEQDLK YIAAIRKAIGPDMRLMIDSNHAYCYKEAIELARKAEKFDI SWFEEPVSPEDYDGYKRLRQNTTIPISGGECEYLKYGFKR LFDKDCVDIAQPDICAAGGLTEVKKIATLAQTYNVDLVPH TWGTWIAISAAVHLVANLDLPTMELDRTENALRDEVTLHK IKLENGHLEVPCTPGLGVDVDMDKLEHYLDK Description Functional site 1) chain H residue 164 type sequence K description binding site for residue MG H 401 source : AC5 2) chain H residue 194 type sequence D description binding site for residue MG H 401 source : AC5 3) chain H residue 220 type sequence E description binding site for residue MG H 401 source : AC5 4) chain H residue 246 type sequence E description binding site for residue MG H 401 source : AC5

Display surface Download Links