eF-site ID 5olc-G PDB Code 5olc Chain G click to enlarge Title Crystal structure of the 3,6-anhydro-D-galactonate cycloisomerase from Zobellia galactanivorans Classification ISOMERASE Compound Galactonate dehydratase Source Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) (G0L7B8_ZOBGA) Sequence G:  SKIKKIEPYVISHKLDDTRKICIVKITLDDGTYGWGEGYG PAAVIKSGIDFFTPFLLGKEAIGHEVLWQEMYRRSMDYAR SGVLQAAISAIDVALWDIKGKLLNLPVSVLLGGVKNPIIE PYATGLYLEELLVEEALLYKSQGFKATKMKVGLGIEQDLK YIAAIRKAIGPDMRLMIDSNHAYCYKEAIELARKAEKFDI SWFEEPVSPEDYDGYKRLRQNTTIPISGGECEYLKYGFKR LFDKDCVDIAQPDICAAGGLTEVKKIATLAQTYNVDLVPH TWGTWIAISAAVHLVANLDLPTMELDRTENALRDEVTLHK IKLENGHLEVPCTPGLGVDVDMDKLEHYLDK Description Functional site 1) chain G residue 164 type sequence K description binding site for residue MG G 401 source : AC4 2) chain G residue 194 type sequence D description binding site for residue MG G 401 source : AC4 3) chain G residue 220 type sequence E description binding site for residue MG G 401 source : AC4 4) chain G residue 246 type sequence E description binding site for residue MG G 401 source : AC4

Display surface Download Links