eF-site ID 5oe7-B
PDB Code 5oe7
Chain B

click to enlarge
Title Structure of OTULIN bound to the Met1-linked diubiquitin activity probe
Classification HYDROLASE
Compound Ubiquitin thioesterase otulin
Source Homo sapiens (Human) (UBC_HUMAN)
Sequence B:  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGXMQIF
VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLV
Description (1)  Ubiquitin thioesterase otulin (E.C.3.4.19.12), Polyubiquitin-C


Functional site

1) chain B
residue 54
type BINDING
ligand
sequence R
description Activating enzyme.
source Swiss-Prot : SWS_FT_FI4

2) chain B
residue 72
type BINDING
ligand
sequence R
description Activating enzyme.
source Swiss-Prot : SWS_FT_FI4

3) chain B
residue 68
type SITE
ligand
sequence H
description Essential for function.
source Swiss-Prot : SWS_FT_FI5

4) chain B
residue 74-75
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence RG
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

5) chain B
residue 77-78
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence MQ
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76


Display surface

Download
Links