eF-site ID 5oe7-AB
PDB Code 5oe7
Chain A, B

click to enlarge
Title Structure of OTULIN bound to the Met1-linked diubiquitin activity probe
Classification HYDROLASE
Compound Ubiquitin thioesterase otulin
Source Homo sapiens (Human) (UBC_HUMAN)
Sequence A:  GPLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKF
TSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLL
PEKLISKYNWIKQWKLGLDLVDKIKESLTLLRKKWAGLAE
MRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELY
NDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTG
GLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPP
KDWPVVTLIAEDDRHYNIPVRVCEET
B:  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGXMQIF
VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLV
Description (1)  Ubiquitin thioesterase otulin (E.C.3.4.19.12), Polyubiquitin-C


Functional site

1) chain A
residue 262
type ACT_SITE
ligand
sequence A
description {ECO:0000244|PDB:3ZNZ, ECO:0000244|PDB:4KSL, ECO:0000269|PubMed:23708998, ECO:0000269|PubMed:23746843}.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 237
type BINDING
ligand
sequence L
description Linear diubiquitin. {ECO:0000244|PDB:3ZNZ, ECO:0000244|PDB:4KSK, ECO:0000244|PDB:4KSL, ECO:0000269|PubMed:23708998, ECO:0000269|PubMed:23746843}.
source Swiss-Prot : SWS_FT_FI3

3) chain B
residue 54
type BINDING
ligand
sequence R
description Activating enzyme.
source Swiss-Prot : SWS_FT_FI4

4) chain B
residue 72
type BINDING
ligand
sequence R
description Activating enzyme.
source Swiss-Prot : SWS_FT_FI4

5) chain B
residue 68
type SITE
ligand
sequence H
description Essential for function.
source Swiss-Prot : SWS_FT_FI5

6) chain A
residue 124-130
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence RGDNYCA
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

7) chain A
residue 285
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence G
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

8) chain A
residue 338-340
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence RHY
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

9) chain B
residue 74-75
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence RG
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

10) chain B
residue 77-78
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence MQ
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76


Display surface

Download
Links