eF-site ID 5oe7-A
PDB Code 5oe7
Chain A

click to enlarge
Title Structure of OTULIN bound to the Met1-linked diubiquitin activity probe
Classification HYDROLASE
Compound Ubiquitin thioesterase otulin
Source Homo sapiens (Human) (UBC_HUMAN)
Sequence A:  GPLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKF
TSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLL
PEKLISKYNWIKQWKLGLDLVDKIKESLTLLRKKWAGLAE
MRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELY
NDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTG
GLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPP
KDWPVVTLIAEDDRHYNIPVRVCEET
Description (1)  Ubiquitin thioesterase otulin (E.C.3.4.19.12), Polyubiquitin-C


Functional site

1) chain A
residue 262
type ACT_SITE
ligand
sequence A
description {ECO:0000244|PDB:3ZNZ, ECO:0000244|PDB:4KSL, ECO:0000269|PubMed:23708998, ECO:0000269|PubMed:23746843}.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 237
type BINDING
ligand
sequence L
description Linear diubiquitin. {ECO:0000244|PDB:3ZNZ, ECO:0000244|PDB:4KSK, ECO:0000244|PDB:4KSL, ECO:0000269|PubMed:23708998, ECO:0000269|PubMed:23746843}.
source Swiss-Prot : SWS_FT_FI3

3) chain A
residue 124-130
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence RGDNYCA
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

4) chain A
residue 285
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence G
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76

5) chain A
residue 338-340
type binding
ligand DHA: 2-AMINO-ACRYLIC ACID
sequence RHY
description 2-AMINO-ACRYLIC ACID binding site
source pdb_hetatom : DHA_5oe7_B_76


Display surface

Download
Links