eF-site ID 5o5q-C PDB Code 5o5q Chain C click to enlarge Title X-ray crystal structure of RapZ from Escherichia coli (P3221 space group) Classification CHAPERONE Compound RNase adapter protein RapZ Source Escherichia coli (strain K12) (RAPZ_ECOLI) Sequence C:  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDL ARTLADREISAAVSIDVRNSPEIFEQAMSNLPDAFSPQLL FLDDRNTLIRRYESAIDKESDLLEPLRSRADLIVDELAEM LRTRLLGKERELTMVFESFGFKHGIPIDADYVFDVRFLPN PHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLEL WLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSR GKNVQSRHRTLEKR Description (1)  RNase adapter protein RapZ Functional site 1) chain C residue 220 type sequence Y description binding site for residue SO4 B 302 source : AC6 2) chain C residue 223 type sequence R description binding site for residue SO4 B 302 source : AC6 3) chain C residue 188 type sequence N description binding site for residue SO4 C 301 source : AD4 4) chain C residue 190 type sequence H description binding site for residue SO4 C 301 source : AD4 5) chain C residue 248 type sequence T description binding site for residue SO4 C 301 source : AD4 6) chain C residue 249 type sequence G description binding site for residue SO4 C 301 source : AD4 7) chain C residue 253 type sequence R description binding site for residue SO4 C 301 source : AD4 8) chain C residue 9 type sequence R description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 9) chain C residue 11 type sequence G description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 10) chain C residue 12 type sequence S description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 11) chain C residue 13 type sequence G description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 12) chain C residue 15 type sequence S description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 13) chain C residue 16 type sequence V description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 14) chain C residue 17 type sequence A description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 15) chain C residue 18 type sequence L description binding site for Di-peptide SO4 C 302 and LYS C 14 source : AD5 16) chain C residue 8 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00636 source Swiss-Prot : SWS_FT_FI1 17) chain C residue 56 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_00636 source Swiss-Prot : SWS_FT_FI1 18) chain C residue 251 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links