eF-site ID 5o5o-D
PDB Code 5o5o
Chain D

click to enlarge
Title X-ray crystal structure of RapZ from Escherichia coli (P32 space group)
Classification CHAPERONE
Compound RNase adapter protein RapZ
Source Escherichia coli (strain K12) (RAPZ_ECOLI)
Sequence D:  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDL
ARTLADSAAVSIDVRNMPESPEIFEQAMSNLPDAFSPQLL
FLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDKESDLL
EPLRSRADLIVDTSEMSVHELAEMLRTRELTMVFESFGFK
HGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLD
RHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGG
KHRSVYIAEQLADYFRSRGKNVQSRHRTLEK
Description (1)  RNase adapter protein RapZ


Functional site

1) chain D
residue 190
type
ligand
sequence H
description binding site for residue SO4 D 301
source : AC7

2) chain D
residue 247
type
ligand
sequence C
description binding site for residue SO4 D 301
source : AC7

3) chain D
residue 248
type
ligand
sequence T
description binding site for residue SO4 D 301
source : AC7

4) chain D
residue 249
type
ligand
sequence G
description binding site for residue SO4 D 301
source : AC7

5) chain D
residue 250
type
ligand
sequence G
description binding site for residue SO4 D 301
source : AC7

6) chain D
residue 251
type
ligand
sequence K
description binding site for residue SO4 D 301
source : AC7

7) chain D
residue 252
type
ligand
sequence H
description binding site for residue SO4 D 301
source : AC7

8) chain D
residue 253
type
ligand
sequence R
description binding site for residue SO4 D 301
source : AC7

9) chain D
residue 101
type
ligand
sequence R
description binding site for residue SO4 D 302
source : AC8

10) chain D
residue 102
type
ligand
sequence L
description binding site for residue SO4 D 302
source : AC8

11) chain D
residue 103
type
ligand
sequence H
description binding site for residue SO4 D 302
source : AC8

12) chain D
residue 109
type
ligand
sequence N
description binding site for residue SO4 D 302
source : AC8

13) chain D
residue 95
type
ligand
sequence R
description binding site for residue SO4 D 303
source : AC9

14) chain D
residue 139
type
ligand
sequence M
description binding site for residue SO4 D 303
source : AC9

15) chain D
residue 140
type
ligand
sequence S
description binding site for residue SO4 D 303
source : AC9

16) chain D
residue 141
type
ligand
sequence V
description binding site for residue SO4 D 303
source : AC9

17) chain D
residue 11
type
ligand
sequence G
description binding site for residue SO4 D 304
source : AD1

18) chain D
residue 12
type
ligand
sequence S
description binding site for residue SO4 D 304
source : AD1

19) chain D
residue 13
type
ligand
sequence G
description binding site for residue SO4 D 304
source : AD1

20) chain D
residue 14
type
ligand
sequence K
description binding site for residue SO4 D 304
source : AD1

21) chain D
residue 15
type
ligand
sequence S
description binding site for residue SO4 D 304
source : AD1

22) chain D
residue 56-59
type NP_BIND
ligand
sequence DVRN
description GTP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI7

23) chain D
residue 8-15
type NP_BIND
ligand
sequence GRSGSGKS
description ATP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI8


Display surface

Download
Links