eF-site ID 5o5o-ABCD
PDB Code 5o5o
Chain A, B, C, D

click to enlarge
Title X-ray crystal structure of RapZ from Escherichia coli (P32 space group)
Classification CHAPERONE
Compound RNase adapter protein RapZ
Source Escherichia coli (strain K12) (RAPZ_ECOLI)
Sequence A:  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDL
ARTLADREISAAVSIDVRNMPESPEIFEQAMSNLPDAFSP
QLLFLDADRNTLIRRYSDTLESAIDKESDLLEPLRSRADL
IVDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHG
IPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRH
TEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKH
RSVYIAEQLADYFRSRGKNVQSRHRTLEK
B:  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDL
ARTLADREISAAVSIDVRNMPSPEIFEQAMSNLPDFSPQL
LFLDADRNTLIRRYAIDKESDLLEPLRSRADLIVDTSEMS
VHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYV
FDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIY
QTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQ
LADYFRSRGKNVQSRHRTLEK
C:  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDL
ARTLADREISAAVSIDVRNMPESPEIFEQAMSNLPDAFSP
QLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDKES
DLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLELTMVFE
SFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPV
AAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAI
GCTGGKHRSVYIAEQLADYFRSRGKNVQSRHRTLEK
D:  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDL
ARTLADSAAVSIDVRNMPESPEIFEQAMSNLPDAFSPQLL
FLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDKESDLL
EPLRSRADLIVDTSEMSVHELAEMLRTRELTMVFESFGFK
HGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLD
RHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGG
KHRSVYIAEQLADYFRSRGKNVQSRHRTLEK
Description (1)  RNase adapter protein RapZ


Functional site

1) chain A
residue 188
type
ligand
sequence N
description binding site for residue SO4 A 301
source : AC1

2) chain A
residue 190
type
ligand
sequence H
description binding site for residue SO4 A 301
source : AC1

3) chain A
residue 247
type
ligand
sequence C
description binding site for residue SO4 A 301
source : AC1

4) chain A
residue 248
type
ligand
sequence T
description binding site for residue SO4 A 301
source : AC1

5) chain A
residue 249
type
ligand
sequence G
description binding site for residue SO4 A 301
source : AC1

6) chain A
residue 253
type
ligand
sequence R
description binding site for residue SO4 A 301
source : AC1

7) chain A
residue 10
type
ligand
sequence S
description binding site for residue SO4 A 302
source : AC2

8) chain A
residue 11
type
ligand
sequence G
description binding site for residue SO4 A 302
source : AC2

9) chain A
residue 12
type
ligand
sequence S
description binding site for residue SO4 A 302
source : AC2

10) chain A
residue 13
type
ligand
sequence G
description binding site for residue SO4 A 302
source : AC2

11) chain A
residue 14
type
ligand
sequence K
description binding site for residue SO4 A 302
source : AC2

12) chain A
residue 15
type
ligand
sequence S
description binding site for residue SO4 A 302
source : AC2

13) chain B
residue 188
type
ligand
sequence N
description binding site for residue SO4 B 301
source : AC3

14) chain B
residue 190
type
ligand
sequence H
description binding site for residue SO4 B 301
source : AC3

15) chain B
residue 247
type
ligand
sequence C
description binding site for residue SO4 B 301
source : AC3

16) chain B
residue 248
type
ligand
sequence T
description binding site for residue SO4 B 301
source : AC3

17) chain B
residue 249
type
ligand
sequence G
description binding site for residue SO4 B 301
source : AC3

18) chain B
residue 253
type
ligand
sequence R
description binding site for residue SO4 B 301
source : AC3

19) chain B
residue 188
type
ligand
sequence N
description binding site for residue SO4 B 302
source : AC4

20) chain B
residue 253
type
ligand
sequence R
description binding site for residue SO4 B 302
source : AC4

21) chain C
residue 150
type
ligand
sequence T
description binding site for residue SO4 B 302
source : AC4

22) chain A
residue 235
type
ligand
sequence T
description binding site for residue SO4 C 301
source : AC5

23) chain C
residue 190
type
ligand
sequence H
description binding site for residue SO4 C 301
source : AC5

24) chain C
residue 247
type
ligand
sequence C
description binding site for residue SO4 C 301
source : AC5

25) chain C
residue 248
type
ligand
sequence T
description binding site for residue SO4 C 301
source : AC5

26) chain C
residue 249
type
ligand
sequence G
description binding site for residue SO4 C 301
source : AC5

27) chain A
residue 220
type
ligand
sequence Y
description binding site for residue SO4 C 302
source : AC6

28) chain A
residue 223
type
ligand
sequence R
description binding site for residue SO4 C 302
source : AC6

29) chain C
residue 101
type
ligand
sequence R
description binding site for residue SO4 C 302
source : AC6

30) chain C
residue 102
type
ligand
sequence L
description binding site for residue SO4 C 302
source : AC6

31) chain C
residue 103
type
ligand
sequence H
description binding site for residue SO4 C 302
source : AC6

32) chain C
residue 109
type
ligand
sequence N
description binding site for residue SO4 C 302
source : AC6

33) chain B
residue 235
type
ligand
sequence T
description binding site for residue SO4 D 301
source : AC7

34) chain D
residue 190
type
ligand
sequence H
description binding site for residue SO4 D 301
source : AC7

35) chain D
residue 247
type
ligand
sequence C
description binding site for residue SO4 D 301
source : AC7

36) chain D
residue 248
type
ligand
sequence T
description binding site for residue SO4 D 301
source : AC7

37) chain D
residue 249
type
ligand
sequence G
description binding site for residue SO4 D 301
source : AC7

38) chain D
residue 250
type
ligand
sequence G
description binding site for residue SO4 D 301
source : AC7

39) chain D
residue 251
type
ligand
sequence K
description binding site for residue SO4 D 301
source : AC7

40) chain D
residue 252
type
ligand
sequence H
description binding site for residue SO4 D 301
source : AC7

41) chain D
residue 253
type
ligand
sequence R
description binding site for residue SO4 D 301
source : AC7

42) chain B
residue 220
type
ligand
sequence Y
description binding site for residue SO4 D 302
source : AC8

43) chain B
residue 223
type
ligand
sequence R
description binding site for residue SO4 D 302
source : AC8

44) chain D
residue 101
type
ligand
sequence R
description binding site for residue SO4 D 302
source : AC8

45) chain D
residue 102
type
ligand
sequence L
description binding site for residue SO4 D 302
source : AC8

46) chain D
residue 103
type
ligand
sequence H
description binding site for residue SO4 D 302
source : AC8

47) chain D
residue 109
type
ligand
sequence N
description binding site for residue SO4 D 302
source : AC8

48) chain D
residue 95
type
ligand
sequence R
description binding site for residue SO4 D 303
source : AC9

49) chain D
residue 139
type
ligand
sequence M
description binding site for residue SO4 D 303
source : AC9

50) chain D
residue 140
type
ligand
sequence S
description binding site for residue SO4 D 303
source : AC9

51) chain D
residue 141
type
ligand
sequence V
description binding site for residue SO4 D 303
source : AC9

52) chain D
residue 11
type
ligand
sequence G
description binding site for residue SO4 D 304
source : AD1

53) chain D
residue 12
type
ligand
sequence S
description binding site for residue SO4 D 304
source : AD1

54) chain D
residue 13
type
ligand
sequence G
description binding site for residue SO4 D 304
source : AD1

55) chain D
residue 14
type
ligand
sequence K
description binding site for residue SO4 D 304
source : AD1

56) chain D
residue 15
type
ligand
sequence S
description binding site for residue SO4 D 304
source : AD1

57) chain B
residue 7
type
ligand
sequence S
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

58) chain B
residue 8
type
ligand
sequence G
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

59) chain B
residue 11
type
ligand
sequence G
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

60) chain B
residue 13
type
ligand
sequence G
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

61) chain B
residue 15
type
ligand
sequence S
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

62) chain B
residue 16
type
ligand
sequence V
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

63) chain B
residue 17
type
ligand
sequence A
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

64) chain B
residue 18
type
ligand
sequence L
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

65) chain B
residue 56
type
ligand
sequence D
description binding site for Di-peptide SO4 B 303 and LYS B 14
source : AD2

66) chain C
residue 6
type
ligand
sequence V
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

67) chain C
residue 8
type
ligand
sequence G
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

68) chain C
residue 9
type
ligand
sequence R
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

69) chain C
residue 10
type
ligand
sequence S
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

70) chain C
residue 11
type
ligand
sequence G
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

71) chain C
residue 12
type
ligand
sequence S
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

72) chain C
residue 13
type
ligand
sequence G
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

73) chain C
residue 15
type
ligand
sequence S
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

74) chain C
residue 16
type
ligand
sequence V
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

75) chain C
residue 17
type
ligand
sequence A
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

76) chain C
residue 18
type
ligand
sequence L
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

77) chain C
residue 56
type
ligand
sequence D
description binding site for Di-peptide SO4 C 303 and LYS C 14
source : AD3

78) chain A
residue 56-59
type NP_BIND
ligand
sequence DVRN
description GTP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI1

79) chain A
residue 8-15
type NP_BIND
ligand
sequence GRSGSGKS
description ATP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI2

80) chain B
residue 56-59
type NP_BIND
ligand
sequence DVRN
description GTP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI3

81) chain B
residue 8-15
type NP_BIND
ligand
sequence GRSGSGKS
description ATP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI4

82) chain C
residue 56-59
type NP_BIND
ligand
sequence DVRN
description GTP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI5

83) chain C
residue 8-15
type NP_BIND
ligand
sequence GRSGSGKS
description ATP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI6

84) chain D
residue 56-59
type NP_BIND
ligand
sequence DVRN
description GTP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI7

85) chain D
residue 8-15
type NP_BIND
ligand
sequence GRSGSGKS
description ATP. {ECO:0000255|HAMAP-Rule:MF_00636}.
source Swiss-Prot : SWS_FT_FI8


Display surface

Download
Links