eF-site ID 5o1c-B PDB Code 5o1c Chain B click to enlarge Title p53 cancer mutant Y220C in complex with compound MB184 Classification DNA BINDING PROTEIN Compound Cellular tumor antigen p53 Source Homo sapiens (Human) (P53_HUMAN) Sequence B:  SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLF CQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR RCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRH SVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTI ITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR Description Functional site 1) chain B residue 176 type sequence C description binding site for residue ZN B 401 source : AC3 2) chain B residue 179 type sequence H description binding site for residue ZN B 401 source : AC3 3) chain B residue 238 type sequence C description binding site for residue ZN B 401 source : AC3 4) chain B residue 242 type sequence C description binding site for residue ZN B 401 source : AC3 5) chain B residue 145 type sequence L description binding site for residue 9GZ B 402 source : AC4 6) chain B residue 150 type sequence T description binding site for residue 9GZ B 402 source : AC4 7) chain B residue 151 type sequence P description binding site for residue 9GZ B 402 source : AC4 8) chain B residue 152 type sequence P description binding site for residue 9GZ B 402 source : AC4 9) chain B residue 153 type sequence P description binding site for residue 9GZ B 402 source : AC4 10) chain B residue 220 type sequence C description binding site for residue 9GZ B 402 source : AC4 11) chain B residue 221 type sequence E description binding site for residue 9GZ B 402 source : AC4 12) chain B residue 222 type sequence P description binding site for residue 9GZ B 402 source : AC4 13) chain B residue 223 type sequence P description binding site for residue 9GZ B 402 source : AC4 14) chain B residue 230 type sequence T description binding site for residue 9GZ B 402 source : AC4 15) chain B residue 120 type MOD_RES sequence K description N6-acetyllysine; by KAT6A => ECO:0000269|PubMed:23431171 source Swiss-Prot : SWS_FT_FI4 16) chain B residue 183 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI5 17) chain B residue 269 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI5 18) chain B residue 284 type MOD_RES sequence T description Phosphothreonine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI6 19) chain B residue 176 type BINDING sequence C description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 20) chain B residue 179 type BINDING sequence H description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 21) chain B residue 238 type BINDING sequence C description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 22) chain B residue 242 type BINDING sequence C description BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI2 23) chain B residue 120 type SITE sequence K description Interaction with DNA => ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:18996393, ECO:0000269|PubMed:20364130 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links