eF-site ID 5nwn-B PDB Code 5nwn Chain B click to enlarge Title Deinococcus radiodurans BphP PAS-GAF-PHY Y263F mutant, dark Classification TRANSFERASE Compound Bacteriophytochrome Source (BPHY_DEIRA) Sequence B:  PFFPPLYLGGPEITTENCEREPIHIPGSIQPHGALLTADG HSGEVLQMSLNAATFLGQEPTVLRGQTLAALLPEQWPALQ AALPPGCPDALQYRATLDWPGHLSLTVHRVGELLILEFEP TEPHALRNAMFALESAPNLRALAEVATQTVRELTGFDRVM LYKFAPDATGEVIAEARREGLHAFLGHRFPASDIPAQARA LYTRHLLRLTADTRAAAVPLDPVLNPQTNAPTPLGGAVLR ATSPMHMQFLRNMGVGSSLSVSVVVGGQLWGLIACHHQTP YVLPPDLRTTLEYLGRLLSLQVQVKEAADVAAFRQSLREH HARVALAAAHSLSPHDTLSDPALDLLGLMRAGGLILRFEG RWQTLGEVPPAPAVDALLAWLETQPGALVQTDALGQLWPA GADLAPSAAGLLAISVGEGWSECLVWLRPELRLEDLGPRH SFDTYLEEKRGYAEPWHPGEIEEAQDLRDTLTGAL Description Functional site 1) chain B residue 20 type sequence T description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 2) chain B residue 21 type sequence T description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 3) chain B residue 23 type sequence N description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 4) chain B residue 25 type sequence E description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 5) chain B residue 26 type sequence R description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 6) chain B residue 27 type sequence E description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 7) chain B residue 174 type sequence M description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 8) chain B residue 203 type sequence F description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 9) chain B residue 207 type sequence D description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 10) chain B residue 208 type sequence I description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 11) chain B residue 209 type sequence P description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 12) chain B residue 211 type sequence Q description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 13) chain B residue 216 type sequence Y description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 14) chain B residue 254 type sequence R description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 15) chain B residue 257 type sequence S description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 16) chain B residue 260 type sequence H description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 17) chain B residue 263 type sequence F description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 18) chain B residue 272 type sequence S description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 19) chain B residue 274 type sequence S description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 20) chain B residue 290 type sequence H description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 21) chain B residue 463 type sequence L description binding site for Di-peptide LBV B 600 and CYS B 24 source : AC2 22) chain B residue 24 type BINDING sequence C description covalent => ECO:0000305 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links