eF-site ID 5no2-M PDB Code 5no2 Chain M click to enlarge Title RsgA-GDPNP bound to the 30S ribosomal subunit (RsgA assembly intermediate) Classification RIBOSOME Compound 16S ribosomal RNA Source ORGANISM_SCIENTIFIC: Escherichia coli K-12; Sequence M:  ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAE DVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLM DLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKP Description Functional site 1) chain M residue 20 type sequence T description binding site for residue MG A 1667 source : AI3 2) chain M residue 22 type sequence I description binding site for residue MG A 1667 source : AI3 3) chain M residue 25 type sequence V description binding site for residue MG A 1667 source : AI3 4) chain M residue 10-38 type prosite sequence PDHKHAVIALTSIYGVGKTRSKAILAAAG description ADH_SHORT Short-chain dehydrogenases/reductases family signature. PdhkhavialTsiYGVGKTRSkAILaAAG source prosite : PS00061 5) chain M residue 87-100 type prosite sequence RGLRHRRGLPVRGQ description RIBOSOMAL_S13_1 Ribosomal protein S13 signature. RGlRHrrGlpVRGQ source prosite : PS00646

Display surface Download Links