eF-site ID 5nj9-A PDB Code 5nj9 Chain A click to enlarge Title E. coli Microcin-processing metalloprotease TldD/E with DRVY angiotensin fragment bound Classification HYDROLASE Compound Metalloprotease TldD Source null (5NJ9) Sequence A:  SLNLVSEQLLAANGLKHQDLFAILGQLAERRLDYGDLYFQ SSYHESWVLEDRIIKDGSYNIDQGVGVRAISGEKTGFAYA DQISLLALEQSAQAARTIVRDSGDGKVQTLGAVEHSPLYT SVDPLQSMSREEKLDILRRVDKVAREADKRVQEVTASLSG VYELILVAATDGTLAADVRPLVRLSVSVLVEEDGKRERGA SGGGGRFGYEFFLADLDGEVRADAWAKEAVRMALVNLSAV AAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVF SGQVGELVASELCTVVDDGTMVDRRGSVAIDDEGTPGQYN VLIENGILKGYMQDKLNARLMGMTPTGNGRRESYAHLPMP RMTNTYMLPGKSTPQEIIESVEYGIYAPNFGGGQVDITSD KFVFSTSEAYLIENGKVTKPVKGATLIGSGIETMQQISMV GNDLKLDNGVGVCGKEGQSLPVGVGQPTLKVDNLTVGGTA Description Functional site 1) chain A residue 262 type sequence H description binding site for residue ZN A 501 source : AC1 2) chain A residue 267 type sequence H description binding site for residue ZN A 501 source : AC1 3) chain A residue 454 type sequence C description binding site for residue ZN A 501 source : AC1 4) chain A residue 31 type sequence R description binding site for residue MES A 502 source : AC2 5) chain A residue 32 type sequence R description binding site for residue MES A 502 source : AC2 6) chain A residue 33 type sequence L description binding site for residue MES A 502 source : AC2 7) chain A residue 34 type sequence D description binding site for residue MES A 502 source : AC2 8) chain A residue 104 type sequence G description binding site for residue MES A 502 source : AC2 9) chain A residue 105 type sequence D description binding site for residue MES A 502 source : AC2 10) chain A residue 107 type sequence K description binding site for residue MES A 502 source : AC2 11) chain A residue 171 type sequence T description binding site for residue MES A 502 source : AC2 12) chain A residue 35 type sequence Y description binding site for residue EDO A 503 source : AC3 13) chain A residue 340 type sequence R description binding site for residue EDO A 503 source : AC3 14) chain A residue 117 type sequence S description binding site for residue NA A 504 source : AC4 15) chain A residue 74 type sequence E description binding site for residue EDO B 702 source : AC6

Display surface Download Links