eF-site ID 5nj5-B
PDB Code 5nj5
Chain B

click to enlarge
Title E. coli Microcin-processing metalloprotease TldD/E with phosphate bound
Classification HYDROLASE
Compound Metalloprotease TldD
Source Escherichia coli (strain K12) (PMBA_ECOLI)
Sequence B:  VISQVEAQRKILEEAVSTALELASGKSDGAEVAVSKTTGI
SVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSP
QAIARTVQAALDIARYTSPDPCAGVADKELLAFDAPDLDL
FHPAEVSPDEAIELAARAEQAALQADKRITNTEGGSFNSH
YGVKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYA
YTIGRAMSDLQTPEWVGADCARRTLSRLSPRKLSTMKAPV
IFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQILP
DWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGILTQ
WLLTSYSARKLGLKSTGHAGGIHNWRIAGQGLSFEQMLKE
MGTGLVVTELMGQGVSAITGDYSRGAAGFWVENGEIQYPV
SEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMK
IAGQ
Description (1)  Metalloprotease TldD (E.C.3.4.-.-), Metalloprotease PmbA (E.C.3.4.-.-)


Functional site

1) chain B
residue 51
type
ligand
sequence R
description binding site for residue EDO A 506
source : AC6

2) chain B
residue 75
type
ligand
sequence R
description binding site for residue EDO A 506
source : AC6

3) chain B
residue 213
type
ligand
sequence M
description binding site for residue EDO B 501
source : AC7

4) chain B
residue 214
type
ligand
sequence S
description binding site for residue EDO B 501
source : AC7

5) chain B
residue 216
type
ligand
sequence L
description binding site for residue EDO B 501
source : AC7

6) chain B
residue 218
type
ligand
sequence T
description binding site for residue EDO B 501
source : AC7

7) chain B
residue 288
type
ligand
sequence W
description binding site for residue EDO B 502
source : AC8

8) chain B
residue 356
type
ligand
sequence Q
description binding site for residue EDO B 502
source : AC8

9) chain B
residue 423
type
ligand
sequence V
description binding site for residue EDO B 502
source : AC8

10) chain B
residue 424
type
ligand
sequence T
description binding site for residue EDO B 502
source : AC8

11) chain B
residue 398
type
ligand
sequence E
description binding site for residue EDO D 902
source : AD6

12) chain B
residue 51-52
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence RY
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_5nj5_A_506

13) chain B
residue 157
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_5nj5_A_506

14) chain B
residue 213-218
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence MSDLQT
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_5nj5_B_501

15) chain B
residue 288
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence W
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_5nj5_B_502

16) chain B
residue 356
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence Q
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_5nj5_B_502

17) chain B
residue 423-424
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence VT
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_5nj5_B_502


Display surface

Download
Links