eF-site ID 5nj5-ABCD
PDB Code 5nj5
Chain A, B, C, D

click to enlarge
Title E. coli Microcin-processing metalloprotease TldD/E with phosphate bound
Classification HYDROLASE
Compound Metalloprotease TldD
Source Escherichia coli (strain K12) (PMBA_ECOLI)
Sequence A:  SLNLVSEQLLAANGLKHQDLFAILGQLAERRLDYGDLYFQ
SSYHESWVLEDRIIKDGSYNIDQGVGVRAISGEKTGFAYA
DQISLLALEQSAQAARTIVRDSGDGKVQTLGAVEHSPLYT
SVDPLQSMSREEKLDILRRVDKVAREADKRVQEVTASLSG
VYELILVAATDGTLAADVRPLVRLSVSVLVEEDGKRERGA
SGGGGRFGYEFFLADLDGEVRADAWAKEAVRMALVNLSAV
AAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVF
SGQVGELVASELCTVVDDGTMVDRRGSVAIDDEGTPGQYN
VLIENGILKGYMQDKLNARLMGMTPTGNGRRESYAHLPMP
RMTNTYMLPGKSTPQEIIESVEYGIYAPNFGGGQVDITSD
KFVFSTSEAYLIENGKVTKPVKGATLIGSGIETMQQISMV
GNDLKLDNGVGVCGKEGQSLPVGVGQPTLKVDNLTVGGTA
B:  VISQVEAQRKILEEAVSTALELASGKSDGAEVAVSKTTGI
SVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSP
QAIARTVQAALDIARYTSPDPCAGVADKELLAFDAPDLDL
FHPAEVSPDEAIELAARAEQAALQADKRITNTEGGSFNSH
YGVKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYA
YTIGRAMSDLQTPEWVGADCARRTLSRLSPRKLSTMKAPV
IFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQILP
DWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGILTQ
WLLTSYSARKLGLKSTGHAGGIHNWRIAGQGLSFEQMLKE
MGTGLVVTELMGQGVSAITGDYSRGAAGFWVENGEIQYPV
SEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMK
IAGQ
C:  LNLVSEQLLAANGLKHQDLFAILGQLAERRLDYGDLYFQS
SYHESWVLEDRIIKDGSYNIDQGVGVRAISGEKTGFAYAD
QISLLALEQSAQAARTIVRDSGDGKVQTLGAVEHSPLYTS
VDPLQSMSREEKLDILRRVDKVAREADKRVQEVTASLSGV
YELILVAATDGTLAADVRPLVRLSVSVLVEEDGKRERGAS
GGGGRFGYEFFLADLDGEVRADAWAKEAVRMALVNLSAVA
APAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVFS
GQVGELVASELCTVVDDGTMVDRRGSVAIDDEGTPGQYNV
LIENGILKGYMQDKLNARLMGMTPTGNGRRESYAHLPMPR
MTNTYMLPGKSTPQEIIESVEYGIYAPNFGGGQVDITSDK
FVFSTSEAYLIENGKVTKPVKGATLIGSGIETMQQISMVG
NDLKLDNGVGVCGKEGQSLPVGVGQPTLKVDNLTVGGTA
D:  VISQVEAQRKILEEAVSTALELASGKSDGAEVAVSKTTGI
SVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSP
QAIARTVQAALDIARYTSPDPCAGVADKELLAFDAPDLDL
FHPAEVSPDEAIELAARAEQAALQADKRITNTEGGSFNSH
YGVKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYA
YTIGRAMSDLQTPEWVGADCARRTLSRLSPRKLSTMKAPV
IFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQILP
DWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGILTQ
WLLTSYSARKLGLKSTGHAGGIHNWRIAGQGLSFEQMLKE
MGTGLVVTELMGQGVSAITGDYSRGAAGFWVENGEIQYPV
SEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMK
IAGQ
Description (1)  Metalloprotease TldD (E.C.3.4.-.-), Metalloprotease PmbA (E.C.3.4.-.-)


Functional site

1) chain A
residue 262
type
ligand
sequence H
description binding site for residue ZN A 501
source : AC1

2) chain A
residue 267
type
ligand
sequence H
description binding site for residue ZN A 501
source : AC1

3) chain A
residue 454
type
ligand
sequence C
description binding site for residue ZN A 501
source : AC1

4) chain A
residue 262
type
ligand
sequence H
description binding site for residue PO4 A 502
source : AC2

5) chain A
residue 263
type
ligand
sequence E
description binding site for residue PO4 A 502
source : AC2

6) chain A
residue 267
type
ligand
sequence H
description binding site for residue PO4 A 502
source : AC2

7) chain A
residue 394
type
ligand
sequence G
description binding site for residue PO4 A 502
source : AC2

8) chain A
residue 454
type
ligand
sequence C
description binding site for residue PO4 A 502
source : AC2

9) chain A
residue 455
type
ligand
sequence G
description binding site for residue PO4 A 502
source : AC2

10) chain A
residue 35
type
ligand
sequence Y
description binding site for residue EDO A 503
source : AC3

11) chain A
residue 336
type
ligand
sequence K
description binding site for residue EDO A 503
source : AC3

12) chain A
residue 340
type
ligand
sequence R
description binding site for residue EDO A 503
source : AC3

13) chain A
residue 256
type
ligand
sequence W
description binding site for residue EDO A 504
source : AC4

14) chain A
residue 262
type
ligand
sequence H
description binding site for residue EDO A 504
source : AC4

15) chain A
residue 453
type
ligand
sequence V
description binding site for residue EDO A 504
source : AC4

16) chain A
residue 463
type
ligand
sequence V
description binding site for residue EDO A 504
source : AC4

17) chain A
residue 267
type
ligand
sequence H
description binding site for residue EDO A 505
source : AC5

18) chain A
residue 396
type
ligand
sequence V
description binding site for residue EDO A 505
source : AC5

19) chain A
residue 455
type
ligand
sequence G
description binding site for residue EDO A 505
source : AC5

20) chain A
residue 74
type
ligand
sequence E
description binding site for residue EDO A 506
source : AC6

21) chain B
residue 51
type
ligand
sequence R
description binding site for residue EDO A 506
source : AC6

22) chain B
residue 75
type
ligand
sequence R
description binding site for residue EDO A 506
source : AC6

23) chain B
residue 213
type
ligand
sequence M
description binding site for residue EDO B 501
source : AC7

24) chain B
residue 214
type
ligand
sequence S
description binding site for residue EDO B 501
source : AC7

25) chain B
residue 216
type
ligand
sequence L
description binding site for residue EDO B 501
source : AC7

26) chain B
residue 218
type
ligand
sequence T
description binding site for residue EDO B 501
source : AC7

27) chain D
residue 239
type
ligand
sequence L
description binding site for residue EDO B 501
source : AC7

28) chain D
residue 404
type
ligand
sequence Y
description binding site for residue EDO B 501
source : AC7

29) chain B
residue 288
type
ligand
sequence W
description binding site for residue EDO B 502
source : AC8

30) chain B
residue 356
type
ligand
sequence Q
description binding site for residue EDO B 502
source : AC8

31) chain B
residue 423
type
ligand
sequence V
description binding site for residue EDO B 502
source : AC8

32) chain B
residue 424
type
ligand
sequence T
description binding site for residue EDO B 502
source : AC8

33) chain C
residue 262
type
ligand
sequence H
description binding site for residue ZN C 501
source : AC9

34) chain C
residue 267
type
ligand
sequence H
description binding site for residue ZN C 501
source : AC9

35) chain C
residue 454
type
ligand
sequence C
description binding site for residue ZN C 501
source : AC9

36) chain C
residue 262
type
ligand
sequence H
description binding site for residue PO4 C 502
source : AD1

37) chain C
residue 263
type
ligand
sequence E
description binding site for residue PO4 C 502
source : AD1

38) chain C
residue 267
type
ligand
sequence H
description binding site for residue PO4 C 502
source : AD1

39) chain C
residue 394
type
ligand
sequence G
description binding site for residue PO4 C 502
source : AD1

40) chain C
residue 454
type
ligand
sequence C
description binding site for residue PO4 C 502
source : AD1

41) chain C
residue 455
type
ligand
sequence G
description binding site for residue PO4 C 502
source : AD1

42) chain C
residue 35
type
ligand
sequence Y
description binding site for residue EDO C 503
source : AD2

43) chain C
residue 340
type
ligand
sequence R
description binding site for residue EDO C 503
source : AD2

44) chain C
residue 256
type
ligand
sequence W
description binding site for residue EDO C 504
source : AD3

45) chain C
residue 262
type
ligand
sequence H
description binding site for residue EDO C 504
source : AD3

46) chain C
residue 393
type
ligand
sequence G
description binding site for residue EDO C 504
source : AD3

47) chain C
residue 453
type
ligand
sequence V
description binding site for residue EDO C 504
source : AD3

48) chain C
residue 463
type
ligand
sequence V
description binding site for residue EDO C 504
source : AD3

49) chain C
residue 267
type
ligand
sequence H
description binding site for residue EDO C 505
source : AD4

50) chain C
residue 396
type
ligand
sequence V
description binding site for residue EDO C 505
source : AD4

51) chain C
residue 455
type
ligand
sequence G
description binding site for residue EDO C 505
source : AD4

52) chain C
residue 74
type
ligand
sequence E
description binding site for residue EDO D 901
source : AD5

53) chain D
residue 51
type
ligand
sequence R
description binding site for residue EDO D 901
source : AD5

54) chain D
residue 75
type
ligand
sequence R
description binding site for residue EDO D 901
source : AD5

55) chain B
residue 398
type
ligand
sequence E
description binding site for residue EDO D 902
source : AD6

56) chain D
residue 213
type
ligand
sequence M
description binding site for residue EDO D 902
source : AD6

57) chain D
residue 214
type
ligand
sequence S
description binding site for residue EDO D 902
source : AD6

58) chain D
residue 216
type
ligand
sequence L
description binding site for residue EDO D 902
source : AD6

59) chain D
residue 218
type
ligand
sequence T
description binding site for residue EDO D 902
source : AD6

60) chain D
residue 356
type
ligand
sequence Q
description binding site for residue EDO D 903
source : AD7

61) chain D
residue 423
type
ligand
sequence V
description binding site for residue EDO D 903
source : AD7

62) chain D
residue 424
type
ligand
sequence T
description binding site for residue EDO D 903
source : AD7


Display surface

Download
Links