eF-site ID 5nj5-D PDB Code 5nj5 Chain D click to enlarge Title E. coli Microcin-processing metalloprotease TldD/E with phosphate bound Classification HYDROLASE Compound Metalloprotease TldD Source Escherichia coli (strain K12) (PMBA_ECOLI) Sequence D:  VISQVEAQRKILEEAVSTALELASGKSDGAEVAVSKTTGI SVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSP QAIARTVQAALDIARYTSPDPCAGVADKELLAFDAPDLDL FHPAEVSPDEAIELAARAEQAALQADKRITNTEGGSFNSH YGVKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYA YTIGRAMSDLQTPEWVGADCARRTLSRLSPRKLSTMKAPV IFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQILP DWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGILTQ WLLTSYSARKLGLKSTGHAGGIHNWRIAGQGLSFEQMLKE MGTGLVVTELMGQGVSAITGDYSRGAAGFWVENGEIQYPV SEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMK IAGQ Description Functional site 1) chain D residue 239 type sequence L description binding site for residue EDO B 501 source : AC7 2) chain D residue 404 type sequence Y description binding site for residue EDO B 501 source : AC7 3) chain D residue 51 type sequence R description binding site for residue EDO D 901 source : AD5 4) chain D residue 75 type sequence R description binding site for residue EDO D 901 source : AD5 5) chain D residue 213 type sequence M description binding site for residue EDO D 902 source : AD6 6) chain D residue 214 type sequence S description binding site for residue EDO D 902 source : AD6 7) chain D residue 216 type sequence L description binding site for residue EDO D 902 source : AD6 8) chain D residue 218 type sequence T description binding site for residue EDO D 902 source : AD6 9) chain D residue 356 type sequence Q description binding site for residue EDO D 903 source : AD7 10) chain D residue 423 type sequence V description binding site for residue EDO D 903 source : AD7 11) chain D residue 424 type sequence T description binding site for residue EDO D 903 source : AD7

Display surface Download Links