eF-site ID 5nj5-B PDB Code 5nj5 Chain B click to enlarge Title E. coli Microcin-processing metalloprotease TldD/E with phosphate bound Classification HYDROLASE Compound Metalloprotease TldD Source Escherichia coli (strain K12) (PMBA_ECOLI) Sequence B:  VISQVEAQRKILEEAVSTALELASGKSDGAEVAVSKTTGI SVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSP QAIARTVQAALDIARYTSPDPCAGVADKELLAFDAPDLDL FHPAEVSPDEAIELAARAEQAALQADKRITNTEGGSFNSH YGVKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYA YTIGRAMSDLQTPEWVGADCARRTLSRLSPRKLSTMKAPV IFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQILP DWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGILTQ WLLTSYSARKLGLKSTGHAGGIHNWRIAGQGLSFEQMLKE MGTGLVVTELMGQGVSAITGDYSRGAAGFWVENGEIQYPV SEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMK IAGQ Description Functional site 1) chain B residue 51 type sequence R description binding site for residue EDO A 506 source : AC6 2) chain B residue 75 type sequence R description binding site for residue EDO A 506 source : AC6 3) chain B residue 213 type sequence M description binding site for residue EDO B 501 source : AC7 4) chain B residue 214 type sequence S description binding site for residue EDO B 501 source : AC7 5) chain B residue 216 type sequence L description binding site for residue EDO B 501 source : AC7 6) chain B residue 218 type sequence T description binding site for residue EDO B 501 source : AC7 7) chain B residue 288 type sequence W description binding site for residue EDO B 502 source : AC8 8) chain B residue 356 type sequence Q description binding site for residue EDO B 502 source : AC8 9) chain B residue 423 type sequence V description binding site for residue EDO B 502 source : AC8 10) chain B residue 424 type sequence T description binding site for residue EDO B 502 source : AC8 11) chain B residue 398 type sequence E description binding site for residue EDO D 902 source : AD6

Display surface Download Links